KEGG   Sphaerochaeta coccoides: Spico_0497Help
Entry
Spico_0497        CDS       T01469                                 

Definition
(GenBank) Sucrose phosphorylase
  KO
K22597  glucosylglycerate phosphorylase [EC:2.4.1.352]
Organism
scc  Sphaerochaeta coccoides
Brite
Enzymes [BR:scc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.352  glucosylglycerate phosphorylase
     Spico_0497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459
Motif
Other DBs
NCBI-ProteinID: AEC01725
UniProt: F4GJ85
Position
complement(579317..581029)
Genome map
AA seq 570 aa AA seqDB search
MIDRTVKDRMSSLLAGIYPEDDSETLLDMIDNLVERHRRDIVTHRLKNGASNARYEFDQN
DVFLITYADVAREQDASPLASLHRLLAEHANGLFSFVHILPFYPYSSDDGFSVVDYKEVN
PRFGSWSDVERLAGRYRLMFDAVLNHISVKSHWFTGFLAGESTFEQFFIERDVNADYSRV
VRPRITPLFTSFESLKGTKDLWTTFSPDQVDLNFHNPRVLLAVLDVLLFYVARGASAIRL
DAINYLWKEPGTICSNLPQCHAVIRLMRALLDAVCPWIPLITETNILHADNITYLADGFS
EAQMVYQFALPPLVVHSYLSGDMSKLSAWAKELTFGEGTSYFNFLASHDGVGIIPVGNIL
DKREMDALAALAVARGGYVSYKSNDGGEDVPYELNCTWWELISDPAEPMETNIRKYVASH
AILLALRGVPALYCHSLFGAENDHEGVRETGMKRSVNRRKYALTELRQNLENGRTGRIYG
EVKALIETRKKFRAFSPASGQEIMELHPAVLAVLRTAGDADQVLTLANASGHPVTVRLPI
PGCLIAGSGALNAGHIMLEPHGFAWLEVER
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgatagaccgcaccgtgaaagacagaatgtcttcgctactggcgggaatttatcccgaa
gatgacagcgaaacgctgcttgacatgatcgacaacctcgtggagcgtcatcggagggat
atcgttacccaccggctgaaaaacggtgccagcaacgcacgctacgaattcgaccagaat
gacgtgtttctcatcacctatgccgacgtcgcccgagagcaggacgccagtccactggct
tcgctgcaccgtctgctggccgagcatgccaacggcctgttcagttttgtccatatcttg
cctttttatccctattcttccgatgacgggttttccgtggttgattacaaggaggtcaac
ccgcggttcggttcctggagcgatgtggagcgtcttgctggacgctatcgcctgatgttc
gatgccgtactgaatcatatctccgtgaaaagccactggttcaccggcttcctggccggg
gaatcgactttcgagcaattcttcatcgagcgcgacgtcaacgccgattactcgcgcgtg
gtgcgtccgcgcatcacgcctctgttcacttccttcgaaagcctcaaaggaaccaaagac
ctgtggacaaccttcagccccgaccaggtcgacctcaatttccataacccgcgtgtgctg
ctggctgtactggacgtactgctgttttacgtggccaggggtgccagcgcgatcaggctg
gatgccatcaactacctctggaaggaaccgggtaccatctgttcgaacctgccgcagtgc
catgcggtcatccgcctgatgcgggcgttgctggatgccgtctgcccgtggattccgctg
atcactgagaccaacatcctgcatgccgacaacatcacctatctcgccgacggattcagc
gaggcgcagatggtctaccaattcgcgttaccgccactggtggttcactcctatctcagc
ggcgatatgagcaaactctcggcctgggcaaaagaattgactttcggcgagggaaccagc
tacttcaatttcctggccagccacgacggcgtgggcatcatccctgtaggcaacatcctc
gataaaagggagatggacgctctggcagccctggcggttgcgcgcggcggctatgtctcc
tacaagtccaacgacggcggtgaggatgtcccctacgaattaaactgcacatggtgggag
ctgattagcgaccctgccgagccaatggagactaacatccgcaagtacgtggcatcacat
gccatcctgttggcgctgcgcggtgttcccgcgctgtattgtcactcgctgtttggtgcg
gagaatgatcatgagggcgtcagggaaacaggcatgaagcgcagcgtgaaccgtcgcaag
tacgcactgaccgaattaaggcagaaccttgagaacggcaggactggccggatttacggc
gaggtgaaagcgttaatcgaaaccagaaaaaagttccgggcattcagtcctgcctccgga
caggaaatcatggaactgcatccggcagtgctggccgtcttgcgcactgccggggacgct
gatcaggtactgacgctcgctaacgcttcgggtcatcctgtaacggtcagactgccgatc
cctggatgccttatcgccggcagtggcgcgctcaatgctggtcacattatgctggaacct
catggctttgcctggctggaggtcgagagatga

DBGET integrated database retrieval system