KEGG   Sphaerochaeta coccoides: Spico_0695Help
Entry
Spico_0695        CDS       T01469                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
scc  Sphaerochaeta coccoides
Pathway
scc00900  Terpenoid backbone biosynthesis
scc01100  Metabolic pathways
scc01110  Biosynthesis of secondary metabolites
scc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:scc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Spico_0695
Enzymes [BR:scc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Spico_0695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXPR_C DXP_reductoisom
Motif
Other DBs
NCBI-ProteinID: AEC01921
UniProt: F4GLF1
Position
815010..816182
Genome map
AA seq 390 aa AA seqDB search
MRNTATCRSAIILGCTGSIGITAIKGLSALSSPLRIRALSAHTQAQKLIDSAVSLGAEAV
CLTGARFSDFPVHCPADVRRYDGPHGLRSMLEDIHADVVLNGIAGADGLAASRWTLENGM
DLALANKETIVMAGSLIENTARRNSCSIFPVDSEHSALKALIDAHGRERVSSLVITASGG
PFRTIPMEKLYDITPEQATAHPTWSMGRKISVDSATLANKGLELIEAARLFSFDSSCLEI
VIHPQSIVHSMIRMVDGAVYAQLSPPDMSLPILSALAGGVLPGQGVKALDFTHISLEFEK
ADEKRFPFLALARSCIKGNDALPIVFNAANEVAVHAFLARTCRFPDIYATVEEALARGNW
SQYIEDYEDVMQVDASARRIAQDILSEKHV
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagaaacactgccacctgccgtagtgccatcattctcggatgcaccggtagcatcgga
ataaccgccatcaaggggctctctgccctttcttcccctctgcgcatccgcgccctttca
gcccatacccaagcacaaaagctcattgacagcgcggtcagtctcggcgcggaagccgtc
tgcttgaccggagcacgcttctctgatttccctgttcactgtcctgcggatgtcaggcgt
tatgacggaccgcatggcctgcgctccatgcttgaagacatacatgcagatgtcgtcctg
aatggaatagcgggagcagatggtcttgcagcctcacggtggactctggagaacggaatg
gatctcgccttggcgaacaaggagactattgtcatggccggttctctgatagaaaatacc
gcccggcggaacagttgctccatttttcctgttgacagcgagcacagcgcgctcaaggct
ctgattgacgcgcacggacgggaacgggtctcctcattagtcatcacggcaagtggtggg
ccttttcgtaccatccctatggaaaagctgtacgacatcaccccagagcaagcaaccgcc
cacccaacatggagcatgggcaggaagatatcggttgattccgcgactcttgccaacaaa
ggactggaactcattgaagccgcgcgcctgttctcctttgattcatcctgccttgagatt
gtgattcatcctcagagcatcgttcattcaatgattcgaatggtcgatggcgcagtgtac
gcccagctctctccaccggacatgtcccttcccattctctccgctctggcaggaggcgtg
ctccctggccaaggggtgaaagccctcgattttacacatatttccttggaatttgaaaaa
gccgatgaaaaacgtttccctttccttgccctcgctcgttcctgcatcaaggggaatgat
gctttgcccatagtgttcaatgcggcgaatgaagtggccgtccatgcgttccttgctcgc
acgtgcaggtttcccgacatctacgcgacggttgaagaagcacttgcgcgtggcaattgg
tcacaatatatcgaagactacgaggatgtcatgcaggtagatgcttcggcacgcaggatt
gcacaagacatcctctcggagaaacacgtctga

DBGET integrated database retrieval system