KEGG   Sphaerochaeta coccoides: Spico_0870Help
Entry
Spico_0870        CDS       T01469                                 

Definition
tryptophan synthase subunit beta
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
scc  Sphaerochaeta coccoides
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:scc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Spico_0870
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spico_0870
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Spico_0870
Enzymes [BR:scc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Spico_0870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1008055..1009299
Genome map
AA seq 414 aa AA seqDB search
MSAKNLVTGGISTEGLPREDGFFGEFGGSYIPPRLQDVMDEVTRTYKKIAADPAFIAEFN
DLLIHYAGRPSPVYHAKRLSEHAGGAQIYLKREDLNHTGAHKINHCIGEALLARKMGKKK
VIAETGAGQHGVALATAAALMGLECDIYMGAIDVAKEAPNVSRMKILGARVIEVTRGTQS
LKDAVDAAFEVYLDDPETQLYCIGSAVGPHPFPMIVRDFQSIIGREARGQFMEMTGHLPD
VVTACVGGGSNAIGIFSGFLEDTDVELHGVEPAGKGLETGRHAATMTKGSVGVLHGFKSY
ILQDSQGEPLPVYSIASGLDYPGVGPQHSYLKTIGRVRYETATDAEAVHAFYALSRLEGI
IPALESSHAVAYALRHAKELGKDKRILVNLSGRGDKDIDFIMEHYPYEGDVPSL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaaaaaatttggtcacgggaggcatctccacggaaggattaccacgggaagat
ggttttttcggtgagttcggcggttcatacatccctccccggcttcaggacgtgatggat
gaagtgacacgcacctacaaaaaaatcgctgctgatcccgcgttcattgctgaattcaac
gacctgcttatccattatgctggacgtccctctcccgtatatcacgcgaaaagactgtcc
gaacatgcgggaggcgcccagatatatctcaagcgcgaagacctgaatcataccggagcc
cataagattaaccactgcataggagaagcattgctcgcccgcaagatgggtaagaaaaaa
gtcattgcggaaactggcgcgggacagcacggagtcgcccttgccacggccgccgccctg
atgggactggaatgcgacatctatatgggcgccatagatgtagccaaggaagctcccaat
gtcagcagaatgaaaatcttgggagcccgtgtcatagaagttacacgagggacgcaatcg
ttgaaagacgccgttgatgccgcctttgaagtctatctcgatgatcctgagacccagctt
tattgcataggttcggcggtcggcccacatcctttccccatgattgtccgtgacttccag
agcatcattggaagggaagcacgtggacagttcatggagatgactggtcatctgcccgac
gtcgtcaccgcatgcgtcggcggtggctcgaacgccataggaatcttcagcggtttcctt
gaagatacggacgtggaacttcatggcgtcgaacccgctggaaaaggactggaaactggc
aggcatgccgcgaccatgaccaagggttctgtcggcgtactccacggtttcaagagctac
atcctccaagattcgcaaggagaacctctacctgtgtattccattgccagcggactggat
tatccgggagtcggtcctcagcatagttatctcaagacaatcggacgggtgcggtatgaa
accgcaactgatgcggaagctgttcatgccttctatgctttgagccgtctggaaggcatc
atccctgccctggaatcatcccacgcagtagcctatgctctccgtcatgccaaggaactg
ggaaaagacaagagaatattggtgaatctttccggacggggagacaaggacatagacttc
attatggaacattacccttatgagggagatgtaccgtcattatga

DBGET integrated database retrieval system