KEGG   Sphaerochaeta coccoides: Spico_0870Help
Entry
Spico_0870        CDS       T01469                                 

Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
scc  Sphaerochaeta coccoides
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:scc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Spico_0870
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spico_0870
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Spico_0870
Enzymes [BR:scc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Spico_0870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1008055..1009299
Genome map
AA seq 414 aa AA seqDB search
MSAKNLVTGGISTEGLPREDGFFGEFGGSYIPPRLQDVMDEVTRTYKKIAADPAFIAEFN
DLLIHYAGRPSPVYHAKRLSEHAGGAQIYLKREDLNHTGAHKINHCIGEALLARKMGKKK
VIAETGAGQHGVALATAAALMGLECDIYMGAIDVAKEAPNVSRMKILGARVIEVTRGTQS
LKDAVDAAFEVYLDDPETQLYCIGSAVGPHPFPMIVRDFQSIIGREARGQFMEMTGHLPD
VVTACVGGGSNAIGIFSGFLEDTDVELHGVEPAGKGLETGRHAATMTKGSVGVLHGFKSY
ILQDSQGEPLPVYSIASGLDYPGVGPQHSYLKTIGRVRYETATDAEAVHAFYALSRLEGI
IPALESSHAVAYALRHAKELGKDKRILVNLSGRGDKDIDFIMEHYPYEGDVPSL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaaaaaatttggtcacgggaggcatctccacggaaggattaccacgggaagat
ggttttttcggtgagttcggcggttcatacatccctccccggcttcaggacgtgatggat
gaagtgacacgcacctacaaaaaaatcgctgctgatcccgcgttcattgctgaattcaac
gacctgcttatccattatgctggacgtccctctcccgtatatcacgcgaaaagactgtcc
gaacatgcgggaggcgcccagatatatctcaagcgcgaagacctgaatcataccggagcc
cataagattaaccactgcataggagaagcattgctcgcccgcaagatgggtaagaaaaaa
gtcattgcggaaactggcgcgggacagcacggagtcgcccttgccacggccgccgccctg
atgggactggaatgcgacatctatatgggcgccatagatgtagccaaggaagctcccaat
gtcagcagaatgaaaatcttgggagcccgtgtcatagaagttacacgagggacgcaatcg
ttgaaagacgccgttgatgccgcctttgaagtctatctcgatgatcctgagacccagctt
tattgcataggttcggcggtcggcccacatcctttccccatgattgtccgtgacttccag
agcatcattggaagggaagcacgtggacagttcatggagatgactggtcatctgcccgac
gtcgtcaccgcatgcgtcggcggtggctcgaacgccataggaatcttcagcggtttcctt
gaagatacggacgtggaacttcatggcgtcgaacccgctggaaaaggactggaaactggc
aggcatgccgcgaccatgaccaagggttctgtcggcgtactccacggtttcaagagctac
atcctccaagattcgcaaggagaacctctacctgtgtattccattgccagcggactggat
tatccgggagtcggtcctcagcatagttatctcaagacaatcggacgggtgcggtatgaa
accgcaactgatgcggaagctgttcatgccttctatgctttgagccgtctggaaggcatc
atccctgccctggaatcatcccacgcagtagcctatgctctccgtcatgccaaggaactg
ggaaaagacaagagaatattggtgaatctttccggacggggagacaaggacatagacttc
attatggaacattacccttatgagggagatgtaccgtcattatga

DBGET integrated database retrieval system