KEGG   Spirochaeta coccoides: Spico_0976Help
Entry
Spico_0976        CDS       T01469                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
scc  Spirochaeta coccoides
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:scc00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1128383..1129336)
Genome map
AA seq 317 aa AA seqDB search
MESRAGRLDSRLISCYRAFMTAIHPSYAKVNLHLEVGAKGFDGYHDISTVFHLVSLHDDV
SVELRLSDKFSCSVTGLESICRPGEDSLHRAAEAWCHATGRPLSLDIRVTKRIPSGAGLG
GGSSNAATLLSILDAAAPGGYSMGRKRLMELGTTLGSDVPFFLSGYTAAIGEGRGERLTP
LKAVRDAHALIVMPPFSVSTPHAYLSLDTLRGGDSVSLHRFSFMAGDSSRLSSLLEDDVT
KWMFSNDFRLTCGHEDVYDALEALGRKVPGVFSSLTGSGAAWVFISRKLLSLKDIQTQIS
RLFGVRFVMFSAILLFS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggaatcccgtgccggcaggctcgacagccggttaatctcctgctatcgtgcttttatg
acggcaattcatccatcatatgccaaagtgaaccttcatcttgaagtcggggcaaaaggc
ttcgacggctatcatgacatctccacggtctttcatcttgtcagtctccatgacgatgtt
tcggtggaattaagattgtctgataagttctcttgttccgtgaccggacttgaaagcata
tgccgtccgggtgaggactctctccatcgggcggcggaagcttggtgccacgccacggga
cgcccgctttccttggacatccgtgtcaccaaacgcataccttccggcgccgggctaggc
ggaggctcgtcaaacgcggcaacgctcctttccattctggatgccgctgctccgggagga
tactccatgggaagaaaacgactgatggagctggggactacattgggaagcgatgtgcca
ttctttctttcgggatacactgcggccatcggggaggggagaggcgaaaggctcacgccg
cttaaggcagtccgcgatgcccatgccttgattgtcatgccgccgttttccgtttctacg
cctcatgcatacctaagtctggacactctcagggggggagattccgtctctttacaccgg
ttttcatttatggcaggggattcatcacgtctgtcatccctgcttgaagatgatgtgacc
aaatggatgttttccaatgacttccgcttgacttgtggtcatgaggatgtctatgacgcg
cttgaagcccttggacggaaagtccccggcgtgttttcgtctttgacagggagtggagcc
gcatgggtgttcatcagcaggaagcttttgtccctgaaggatatccaaactcagatttca
agactgtttggggtgagatttgttatgttttctgcaattttgttgttttcttga

DBGET integrated database retrieval system