KEGG   Sphaerochaeta coccoides: Spico_0977Help
Entry
Spico_0977        CDS       T01469                                 

Definition
uracil-DNA glycosylase
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
scc  Sphaerochaeta coccoides
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:scc00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Spico_0977
Enzymes [BR:scc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     Spico_0977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1129300..1130070)
Genome map
AA seq 256 aa AA seqDB search
MKVVESIVNRTRRFAEDVGSTELSFHGYVYNPLEYAWDIHEQYLRRYVRPEAEIMFMGMN
PGPFGMVQTGVPFGEVEAVRSWLGLYGPVGHPSPEHPGRPVEGFSCRRSEVSGQRLWGLM
KERFGSPDIFFSRHCVMNYCPLAFLDSGPRARNVPVDVLPADERRRLEDICSAYIADIIT
MVNPRALVGVGGYARKKLENIIRGMSLSGHSLPMVTGILHPSPGNPAANKGWAQQASDAL
EKAGLWNPVPAGSTAG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtggttgaaagcatcgttaaccgtaccaggcgtttcgccgaagatgtcggaagt
acggagctgtcgttccacggctatgtctacaatccactggaatacgcttgggatatccac
gagcaatacctgcgccgctatgtgcgtccggaggctgaaatcatgttcatgggaatgaat
cccggtccattcggcatggtgcagacaggcgttcctttcggtgaggtcgaagccgtccgt
tcatggcttggtctttacggaccggtggggcatccgtctcctgagcatcctggacgtcca
gtggaaggtttctcctgtagaaggagcgaggtcagcggacaacggctctggggactgatg
aaagaaaggtttggttcccccgacatatttttctcccgtcattgcgttatgaattactgt
cctcttgctttccttgattccggtccccgtgctcgcaatgtgcctgttgatgtccttccc
gctgatgaacgccgcaggctggaggacatctgttccgcgtatatcgccgatatcatcacc
atggtgaacccgcgagctctggtaggggtgggaggctatgcgcggaagaaactggagaac
attatccgtggcatgtcgctttccggccattctcttcctatggtgaccggcatcctccat
cccagcccagggaatcccgcagcaaacaaaggttgggcgcagcaggcgtccgatgctttg
gaaaaggccggactatggaatcccgtgccggcaggctcgacagccggttaa

DBGET integrated database retrieval system