KEGG   Sphaerochaeta coccoides: Spico_0983Help
Entry
Spico_0983        CDS       T01469                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
scc  Sphaerochaeta coccoides
Brite
Enzymes [BR:scc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Spico_0983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1137753..1138583)
Genome map
AA seq 276 aa AA seqDB search
MFSYDVPDYTKGFYQDTVSPVKSARPWALVHEDSVQHAVLCLHGYNGYPGEMALPGLRLF
EAGMDVYAPRYPGHGTSATDFLASRADDWIGTAQAACTDLLARYDDVSLVGHSMGGALAV
IIGARLDISRLVLLAPALVIPDLKRWQVRLISLFTRKIQRNWKSDPSFVMFHEGEPDDDA
YLGEQYWKWRYADKLLDLDSIRRLAVESLPRLSGDVLAISGGQDETVPPQACELATGRGQ
GNNSHLHVPGCTHLIPYDRDPSARDHAMSALVHWLA
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgttttcttatgacgttccggattataccaaaggattctatcaggatactgtctctccg
gtgaaaagcgctcgcccatgggctttggtgcatgaagactcggttcagcatgccgtgctc
tgtctccatgggtataatggctatccgggtgaaatggctttgccaggactgcgcctcttt
gaagcaggcatggatgtctatgctccccgttatccgggacatggcacgtcagccactgat
ttccttgcttcacgtgccgacgactggattggcacagcccaagccgcctgtactgatctc
cttgcccggtatgacgatgtttcactcgtggggcattcgatgggtggggctttggcggtc
atcatcggggcgcggttggacatcagcaggcttgttctcttggcaccagccttggtcatt
cccgatctgaaacgctggcaagtccgcctgatatcacttttcactcgcaaaatacaacgg
aactggaaatctgacccgtccttcgtgatgtttcatgaaggagagcctgacgatgacgcc
tatctcggcgagcagtactggaagtggcggtatgccgacaagttgcttgacttggattcc
atccgcaggcttgcggttgaaagcctgccccgcctgtccggggatgtccttgcaatcagc
ggcgggcaggatgagactgtccctccgcaggcatgcgaactggcgaccggtcgcggtcag
ggaaacaactcacatctccatgttcccggctgtacccatctgattccgtatgaccgcgat
ccctctgcccgtgaccacgccatgagcgccttggttcactggctggcatga

DBGET integrated database retrieval system