KEGG   Sphaerochaeta coccoides: Spico_0983Help
Entry
Spico_0983        CDS       T01469                                 

Definition
(GenBank) hypothetical protein
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
scc  Sphaerochaeta coccoides
Brite
Enzymes [BR:scc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Spico_0983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Hydrolase_4 Abhydrolase_1 Lipase_3 UPF0227 PGAP1 Ser_hydrolase Thioesterase Esterase BAAT_C
Motif
Other DBs
NCBI-ProteinID: AEC02207
UniProt: F4GJE2
Position
complement(1137753..1138583)
Genome map
AA seq 276 aa AA seqDB search
MFSYDVPDYTKGFYQDTVSPVKSARPWALVHEDSVQHAVLCLHGYNGYPGEMALPGLRLF
EAGMDVYAPRYPGHGTSATDFLASRADDWIGTAQAACTDLLARYDDVSLVGHSMGGALAV
IIGARLDISRLVLLAPALVIPDLKRWQVRLISLFTRKIQRNWKSDPSFVMFHEGEPDDDA
YLGEQYWKWRYADKLLDLDSIRRLAVESLPRLSGDVLAISGGQDETVPPQACELATGRGQ
GNNSHLHVPGCTHLIPYDRDPSARDHAMSALVHWLA
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgttttcttatgacgttccggattataccaaaggattctatcaggatactgtctctccg
gtgaaaagcgctcgcccatgggctttggtgcatgaagactcggttcagcatgccgtgctc
tgtctccatgggtataatggctatccgggtgaaatggctttgccaggactgcgcctcttt
gaagcaggcatggatgtctatgctccccgttatccgggacatggcacgtcagccactgat
ttccttgcttcacgtgccgacgactggattggcacagcccaagccgcctgtactgatctc
cttgcccggtatgacgatgtttcactcgtggggcattcgatgggtggggctttggcggtc
atcatcggggcgcggttggacatcagcaggcttgttctcttggcaccagccttggtcatt
cccgatctgaaacgctggcaagtccgcctgatatcacttttcactcgcaaaatacaacgg
aactggaaatctgacccgtccttcgtgatgtttcatgaaggagagcctgacgatgacgcc
tatctcggcgagcagtactggaagtggcggtatgccgacaagttgcttgacttggattcc
atccgcaggcttgcggttgaaagcctgccccgcctgtccggggatgtccttgcaatcagc
ggcgggcaggatgagactgtccctccgcaggcatgcgaactggcgaccggtcgcggtcag
ggaaacaactcacatctccatgttcccggctgtacccatctgattccgtatgaccgcgat
ccctctgcccgtgaccacgccatgagcgccttggttcactggctggcatga

DBGET integrated database retrieval system