KEGG   Sphaerochaeta coccoides: Spico_1068Help
Entry
Spico_1068        CDS       T01469                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
scc  Sphaerochaeta coccoides
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:scc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Spico_1068
  Lipid metabolism
   00561 Glycerolipid metabolism
    Spico_1068
   00600 Sphingolipid metabolism
    Spico_1068
Enzymes [BR:scc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Spico_1068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1229334..1231538)
Genome map
AA seq 734 aa AA seqDB search
MAILFDENTHGFFLHTVNTTYQMQVDTFGFLLHVFYGQRIDGQDMNYLIIPVDRGFSGNP
YDAGTDRRYSLDTLPLEYPVEGVGDYRQPALSITGKNGSTSLDLRYKGHKIFHGKYNIPS
LPALYESEEGMAETLEIILGDETLSLEVSLFYGVFAEKDIITRAVKVVNKSSEDVVMNRI
FSASLDIQHGDGFWDFLHFHGRHNMERICERVRVCHGITLINSRRGISSHHHNPFLILCD
ETTTEDAGSCYGMNLVYSGNFSAGIEQDQTDAIRMFAGLNDENFSWNLTAGESFFAPEVV
LTFSASGFSRLSQNYHDTYRHNLCRGKFKLCRRPIMINNWEATYFAFSSRTLVEIARSAV
DLGIEMLVMDDGWFGKRNDDTSSLGDWKVNLEKIPGGLGLLVDELNSLGLKFGLWVEPEM
VSEDSDLYRKHPDWALCIPNRNPIRSRHQLVLDMSRADVRDYIYTSLCSVLDSANIEYVK
WDMNRSIADWFSCKLLSETQSELSHRYMLGVYDLLERLTSHYPDILFEGCAGGGGRFDPG
MLYYQPLIWCSDNTDPIERLKIQYGTSFAYPVSSVSSHVSAVPNHQTGRCTSFATRCIVA
MSGSFGFELDPRSLSAYDRETIRKQISEYKHFQHIIHDGLYYRLSNPLKDRYAAWMMAYA
DKSAALLNIVVMHVEANPRHVHVLLKGLDGESLYKVEGKTISGKALMNAGLSLSLPTQEY
YSKQIYIERADENA
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atggcgatactttttgatgaaaacactcatggtttttttcttcatactgtaaatacaacg
tatcagatgcaggtggatacgtttggttttctgctgcatgttttctacgggcagcgtatc
gatggtcaggacatgaactacctgatcattccagttgacaggggtttctccgggaatcca
tatgatgcagggacggacaggagatattccttggatacgttgcctttggaatatccggta
gagggagtaggagattaccggcaacctgccctgagtatcacagggaaaaatggaagtact
tccttggatttgcgatacaagggacataagatttttcacggcaaatacaatattccaagt
cttccagctttgtacgaatctgaggaaggtatggcagagacgctggaaatcattcttggt
gatgaaacgctttccttggaagtttcattattttatggagtcttcgctgaaaaagacatc
ataacccgcgctgtcaaagtggtgaacaaaagttctgaagatgttgtcatgaacagaatc
ttttctgcaagcctggatatccagcatggcgacggtttctgggatttcctgcatttccat
ggtcggcataacatggaacgcatctgtgaacgtgtacgggtatgccatggcatcactctg
ataaatagccgtcggggaataagcagtcatcaccacaatccctttctgatcctctgtgat
gaaactactacggaagacgctggatcgtgctacggcatgaatctggtttacagcggcaat
ttcagcgctggcatcgaacaagaccagacagatgccatacgtatgttcgcaggactcaat
gatgagaacttttcatggaacctcaccgcaggggaaagtttctttgccccggaagtcgta
ctgacgttttctgcgtctgggttttcacgtctttcgcagaactatcatgatacgtatcgc
cataatctgtgccgaggaaagttcaaattatgccgtcgtcccataatgatcaacaactgg
gaggctacgtactttgctttctccagcaggacattggttgaaattgccagatctgccgtt
gatttgggtatagaaatgcttgtcatggatgacggatggtttggaaaaaggaatgacgac
acaagtagtctgggggattggaaagtaaaccttgaaaagataccgggaggattgggtctt
ttggttgatgagctcaattcattgggtttgaaattcggactctgggtggaaccggaaatg
gtgagcgaagacagcgatttatatcgtaaacatccggattgggcattatgcattcccaat
cgaaaccccatcaggagccgtcatcaattggtcttggacatgtcgcgggcagacgtgcgg
gattatatatatacatcgctttgctctgtgctggatagtgcaaacatcgagtatgtgaag
tgggatatgaacaggagcattgccgactggttttcctgcaagttgctttctgagacacaa
agcgaactatctcatcgttacatgcttggagtctatgatttgctggaacggctgacaagt
cactatcctgatatcctttttgaagggtgcgctggtggcggcggtcgctttgaccccggc
atgttgtactatcaaccgctgatttggtgcagtgacaacactgatcccattgagcgtttg
aaaatccaatatggaaccagtttcgcctatcctgtttcttcagtgtcttcccatgtttcc
gccgttcctaaccaccagacgggaagatgcacttcttttgcgacacggtgtattgttgcc
atgtcaggaagtttcggttttgaattggatcctcgttctctttcggcttatgacagggag
actatcagaaaacagatttcagagtacaaacattttcagcatatcattcatgatggattg
tattacaggttgagcaatccactgaaagaccgatatgccgcatggatgatggcatatgct
gataagagcgctgccttgcttaatattgtcgtgatgcatgtcgaagcaaatccacggcat
gtccatgtcctgctgaaaggacttgatggtgaaagtctttataaagttgaaggaaaaaca
atttctggaaaagcactcatgaatgcggggctctctctttcattacccactcaggaatat
tattcaaagcagatatatattgagagagccgatgaaaatgcatga

DBGET integrated database retrieval system