KEGG   Spirochaeta coccoides: Spico_1205Help
Entry
Spico_1205        CDS       T01469                                 

Definition
alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
scc  Spirochaeta coccoides
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:scc00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:scc00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:scc00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1397508..1398851)
Genome map
AA seq 447 aa AA seqDB search
MKKTRICIIGGGSRLWAIQFMKDLAYNTTTHGSLVLYDIDKAAARNNVAVARQVFSVNKS
EGRFQVEACDEIGEALSGCDLVVISIEPGKTECRYGDLVLPEEYGILQSVGDTTGPGGIM
RARRALPIFFDFARQIEKYCPDAWVINYTNPMTLCTAALYHAFPGIKALGCCHEVFHTQN
FLADGVSRWFSVPRPDRRDIKIDITGVNHFTFLTKATWQGNDLMPHLLELVSNPAIFTNR
TAQALQRLKDEKWFDCDQIIGLSFFRDFGALGAAGDRHLAEFVPWFLTSDEDLHHYGVIR
TPYDWRLRSAKEKREKVFKDDELVAELSDEEGVDIMRSLMGERTMVTNINFPNEGQINYL
PVGRIVESNGVISQDSIRPLVSSAPPLAVQNLVRQVSDVQQMTLDAVVSGDDGLLFSAFL
CDPLVNISRDKARELFDRMLKASALQY
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagacccgcatctgcatcatcggtggaggaagtcgtctttgggcaatacagttc
atgaaggaccttgcgtacaataccacgacgcacggaagcttggttctgtacgatatcgat
aaggcagcggcacggaacaacgtagctgtcgcgcgtcaagtgttttccgtcaacaaaagc
gaagggcgatttcaggttgaggcatgcgatgagataggcgaggctctctctggttgtgat
ttggtggttatctcaattgagccaggaaagactgaatgccgttacggggatctggttctg
cctgaagaatatggaatcttgcagtccgtcggagataccaccggacccggcggcatcatg
cgtgcccgcagggcattaccgattttctttgatttcgcccgacagattgagaaatactgt
cctgatgcgtgggtcatcaactacaccaatcctatgaccttgtgtactgccgcgctgtac
catgcctttcctgggataaaggctctcggttgctgccatgaggtatttcatacccagaac
ttccttgccgatggagtctcccggtggttctccgtcccccgaccggaccgcagggatata
aagattgacattacgggggtaaatcacttcaccttcctgaccaaggctacctggcagggc
aatgacctgatgccccatcttcttgagcttgtttccaatcccgcgatatttaccaacagg
acggcacaggcactccagaggttgaaggatgagaagtggtttgactgcgaccagatcata
ggtcttagtttctttcgtgatttcggggcattgggggctgccggggatcggcatcttgcc
gagttcgtcccatggttcctgaccagtgacgaagatcttcatcactatggagtgattcgt
acgccttatgattggcggttgcgttcggccaaggagaaaagggagaaggtcttcaaggat
gatgagttggtggctgagctttctgatgaggaaggcgtggacatcatgcgttcccttatg
ggtgaacgtactatggtaaccaatatcaattttcccaacgagggtcagatcaactatctg
cccgtgggacggattgtggagagcaacggggtaatctcacaggattccatccgtcctctt
gtctcgtcagctcctccgttggcagtccaaaatctggtcagacaggtcagtgatgtccag
cagatgacgcttgacgcggttgtctccggagatgatggattgcttttctccgctttcctc
tgtgatcctttggtgaacatttcacgggacaaggcacgggaattgttcgaccggatgctc
aaagcgtccgcgttgcagtattga

DBGET integrated database retrieval system