KEGG   Sphaerochaeta coccoides: Spico_1261Help
Entry
Spico_1261        CDS       T01469                                 

Definition
xylose isomerase domain-containing protein
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
scc  Sphaerochaeta coccoides
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Spico_1261
   00051 Fructose and mannose metabolism
    Spico_1261
Enzymes [BR:scc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Spico_1261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1465868..1466845
Genome map
AA seq 325 aa AA seqDB search
MNKYSVILGNLGNTCDRFLSSGYKEIPPKETLIRQASEINGVKGLELVGTWDVNKDNVNE
MGDLLSKYGLECVSIIPDLFAQRRWGKGSISAKDPAIRAQAMEYLYECVETARILKCGTL
NIWPGQDGYDYILQSDLIQERRWLEENITTLAKSAPDIRFALEYKPKEPRNFSFMARAAD
TLLLAQRTGMDNVGVCIDTGHGYAAGENVGESVVILQEYGKKLFHMHFNDNYGGWDDDMI
VGSVHFPTYVETLFWLKETGYDGWLSMDQYPYREDGKRAVEESVLFLQMIEKHLDSPKVM
DELRSLVTRGNAVETQKWLRETFYK
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaataagtattctgtcatactgggaaacctgggcaatacatgcgacaggttcctctca
tccggctacaaggaaatcccccccaaggaaaccctgatcagacaggcttctgagattaat
ggagtaaaaggtctggaattggtcggtacgtgggatgtaaacaaggacaatgtcaatgag
atgggtgacctgctctcgaaatacggcctggaatgcgtgtcaatcattcccgacctgttt
gcccagcgccgctgggggaaaggctccatttccgcgaaggatccggctatccgcgcacag
gccatggagtatctttacgaatgcgtcgagacagcccgtatcttgaaatgcgggacattg
aacatctggccgggacaggacggctatgattacatcctgcaatcagacctgattcaggaa
cgccgttggcttgaagaaaacatcactacgctggccaagagtgcgccagatatccgtttt
gcgcttgagtataagccaaaagagccgcggaatttcagtttcatggctcgtgcggcggat
acgctcctgcttgcccaaagaaccggcatggacaatgtcggcgtctgcatagacaccgga
cacgggtatgcggcgggagagaacgtcggggaatctgtcgtcatcttacaggagtacgga
aaaaagttgttccatatgcatttcaacgacaattatggaggctgggacgatgacatgatt
gtgggttccgttcatttcccgacatatgtggaaacgctattctggcttaaggaaaccggt
tatgacggttggttgtccatggatcagtatccttaccgggaagacggcaaacgcgcggtc
gaggagagcgtccttttcttgcagatgattgaaaaacatctcgactctcccaaggtcatg
gatgaactgaggagcctggttacaaggggcaacgcagtcgagacccagaagtggttgcgg
gaaactttctataagtaa

DBGET integrated database retrieval system