KEGG   Spirochaeta coccoides: Spico_1393Help
Entry
Spico_1393        CDS       T01469                                 

Definition
dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
scc  Spirochaeta coccoides
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:scc01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:scc00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1635483..1636937)
Genome map
AA seq 484 aa AA seqDB search
MDAYSFLPLGFLADLRALLRIPSVYDGATSDAARPYGAAVADAFAYVLGMGRRDGFSVAE
YDGHVVSISLPGTGEGRIDVISHVDVVEPGTGWSRNPFGAEIEGDILYGRGTQDMKAPFL
VTYYTLKAIKEAGIHPKRELRLVIGGDEERTMDDMVRYVRKAGTPDFAFTPDSAFPVCLG
EKGALMWRIQGSVQTSIEQFEGGVQCNVISPAARAVIRSSATETEYREAFSSLEIFRDGG
VEGSVRSLPSDQISERTSERTSCRIEVNVKGIAAHASRPEDGRSATTALCAAIAHVEDDD
FARLVASVFSDHYGAGANLSRDIPPMGRLTMNLGILRLKEGKVYGEIDCRYPYGVTSGEL
TALLQSACPHLEISLDYDAPPTLADAASPFVTALADIYRKATGDEQSAPFISGGVTYAKV
VPRCVAFGPLMPGGVSLAHQVDECIDLKDISILLRIYGDAMVSLATMDSDDYSFSDEFQG
EKKI
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggacgcatactccttcctccctcttggattcctcgccgatttacgcgccttgctccgc
atcccgtccgtgtacgatggcgcgacttctgatgcagcccgaccatatggagctgctgtc
gcggatgcctttgcttatgtccttgggatgggcaggagggatggtttttctgttgccgaa
tatgacggacatgtcgtttcaatcagcctgcccggaacgggagaagggcgcatcgatgtc
atttcacatgtcgatgtcgtggagccgggtaccgggtggtcccgcaatccgttcggagcg
gaaatcgagggagatatcctctatgggcggggtactcaagacatgaaagctcccttcctg
gtcacgtattatacgttgaaagcaatcaaggaggcgggcatccatcccaagcgggagttg
cggctggtcataggaggggatgaggaaagaaccatggatgacatggtacggtatgtgagg
aaggccggaacgcctgatttcgccttcactccggacagtgcctttcctgtgtgcctggga
gagaagggagctttgatgtggcgcatacagggaagcgtgcagacctctattgaacagttc
gagggaggggtacagtgcaatgtcatttctcctgccgcccgcgccgtcatccgttcctcc
gccacggaaacggagtatcgggaggctttttcttccctggagattttccgtgacggggga
gtggagggaagtgtccgcagcttgccgtcagaccagatatcagagcggacatcagagcga
acatcatgccgaatcgaagtcaacgtgaagggaattgctgcccatgcttcgcgtccggaa
gatggacgcagtgccactacagcactctgcgccgctatagcacatgtggaagatgatgat
ttcgcccgcttggttgcttccgtgttttcagaccattacggagccggagcgaatctttcc
cgcgacatccctcctatgggcagactgaccatgaaccttggcatccttcggctgaaagaa
gggaaagtatacggggaaatcgactgtcgctatccctacggcgtcacatctggtgagctg
acagctcttttgcaaagtgcctgtccccatctggagatatccttggattacgatgcgccg
cctacccttgcggacgcggcatctccctttgtgacagccctggcagacatatacaggaaa
gctacgggagacgaacagtcagcaccctttatcagtggcggcgtcacctatgcgaaagtc
gtgccacgatgcgtggctttcggcccgctgatgccgggaggcgtttccttggcacaccaa
gtggatgagtgcatcgacctgaaggacatctctatcctgctacgcatatacggagatgcc
atggtgtctcttgccactatggacagtgacgattacagtttcagtgatgagtttcaggga
gaaaagaagatatga

DBGET integrated database retrieval system