KEGG   Sphaerochaeta coccoides: Spico_1557Help
Entry
Spico_1557        CDS       T01469                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
scc  Sphaerochaeta coccoides
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scc00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Spico_1557
Enzymes [BR:scc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Spico_1557
Exosome [BR:scc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Spico_1557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1851260..1852759)
Genome map
AA seq 499 aa AA seqDB search
MKFVGSLDQGTTSTRFIIFDEKGNIVASEQKEHRQIFPEPGWVEHDPAEIWENSCACIRG
ALGKAGLSGGDLSGTGITNQRETIIAWNRKTGEPYYHAVVWQDVRGATLIDALKKENSEQ
WLRERSGLLYSPYFSASKIAWLLENIPGLRPAAERGEAVFGTIDTWLMYNLTGRKTCVTD
VTNASRYMLMDLRRREWDDDLLRLFAIPRQALPEIRPSVGEVYGYTEVSGPFAASIPVCG
ILGDQQAALFGQACFGKGEGKNTYGTGCFMLTNTGTVPVLSSSGLITTVAYQEKGRDALY
ALEGSVAVAGSLVQWTRDSLCLVKDVRELDHLAESVEDSGDVYMVPAFSGLFAPWWRDDA
RGVIVGLTGYATRAHICRAVLESTAFQVKDIAEAMEKDSGITLGTLKADGGLTNSKPLMK
FQADLLGIPVIRPQVVETTALGAAYAAGLTAGVWETLGEVRTQWQEGCRWEPHMDEETRS
RKLRQWYKAVDRSLGWMSE
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcgtgggttcattggatcagggtacgaccagcacccgtttcatcatttttgat
gagaaagggaatattgttgcgtcggaacagaaagagcaccggcagatttttcctgaaccc
ggatgggtagagcatgacccggcagagatatgggagaacagttgtgcctgtatccgcggg
gctttggggaaagcaggtctttccggcggtgatttgtccgggacgggcataaccaaccag
cgtgaaaccatcatagcgtggaaccggaagacaggggaaccttattaccatgccgttgtc
tggcaggatgtccgcggcgcaactctgattgatgccttgaagaaagaaaacagtgagcaa
tggctgcgtgagcgcagtggattgctctacagtccgtatttttccgccagcaagattgcg
tggctgcttgagaacattcccggtctccgccccgccgcagagagaggcgaggcggtgttc
ggtaccattgatacatggctgatgtacaacctgacaggcaggaaaacctgcgtgactgat
gtgaccaatgcttcccgctacatgctgatggatttgagacgccgggaatgggatgatgat
ctcctgcgcctttttgctattccccggcaggctctccctgagatccggccttcggtagga
gaggtatatggatacaccgaggtttcagggccctttgccgcgtccattcctgtgtgcggc
attctgggcgaccagcaggcggcgttgttcgggcaggcgtgctttggcaagggtgaagga
aagaacacctatggtacgggatgcttcatgctgaccaataccggtactgttccggttctt
tcttccagcggcctcataactactgtcgcctatcaggagaaaggaagggatgccctgtat
gcccttgaaggttcggtcgcggtcgccggttccctggtgcagtggacgcgggacagtctc
tgtctggtgaaggatgttcgtgagcttgaccatctggcggaaagcgtcgaggattccgga
gatgtctacatggttcctgctttcagtggtctctttgctccgtggtggagagatgatgcc
cgtggcgtcatagtcgggcttaccgggtatgctacccgcgcccatatctgccgcgcagtg
cttgagtccaccgcgttccaggtcaaggacatagccgaggcaatggagaaggacagcggc
atcacgctggggacgctcaaggcggacggtggtctgacgaacagtaagccgctgatgaaa
ttccaggctgacctgctcggtatcccggtgattcgtccccaggtcgttgaaacgactgcc
ttgggcgccgcgtatgccgctggactgaccgcaggcgtgtgggaaaccttgggggaagtc
aggactcaatggcaggagggctgtcgctgggagccgcatatggatgaggagacacgctcg
cggaagctccggcaatggtacaaggcggtggatcgctccctgggttggatgagtgaatag

DBGET integrated database retrieval system