KEGG   Sphaerochaeta coccoides: Spico_1597Help
Entry
Spico_1597        CDS       T01469                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
scc  Sphaerochaeta coccoides
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Spico_1597
Enzymes [BR:scc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Spico_1597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1891973..1893505)
Genome map
AA seq 510 aa AA seqDB search
MKNKTERRVAGILLHPGMLPGAYGIGDFGQGSRDFLDLLSRMQVSLWQILPLGPTGYGDS
PYAARSSFAGNELLIDLRSLAIEGFLDIDALLSAPSFPSDYVDYAAVRAWKEPLLALAAA
RFLKTADDTLMEEFHAFCAAQAGWLEDYALYEVLCVHYGDSRWFTTWDKDIALRKPDALV
SWREKKAVELENAKIRQFFFFRQWQAVRSYAHGKGISIIGDLPIYVAADSADAWSHRELL
SFSPDGVQTELGGVPPDAFSATGQLWGNPVYAWEKHEEDGFAWWTRRLAAAFSQVDILRL
DHFRGFAACWVVPASASTAASGRWVASPGTRLLAAAREKLGNMDIIAEDLGVITPDVEQL
RVENGFPGMKILQFAFEKKDGRFNPHHDYLPHEYDYDSAAYTGTHDNQTSRGWFSSLSHE
YKDMVRCYLQCDDGDVVWQMIRVIMMSRARYAVFPIQDILGCGDEARFNTPGTCGTHNWG
WRMNPEALQGWMVERFSGMVTMYGRSTGQA
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaagaataaaacagaaagacgcgtggcaggtatcctgctgcatcccggcatgttgccc
ggagcctatggcatcggggatttcggacagggttcccgtgatttccttgacctgctttcc
cgtatgcaagtctcgctctggcaaatcctccctcttggccccacaggatacggggattcc
ccatatgccgcccgctcatccttcgccggcaatgaacttctcattgacctgcgctccctt
gccattgagggatttcttgatattgatgccttgctttccgccccgtcctttccatctgat
tacgtagattatgccgctgtgcgtgcatggaaggaaccgctgcttgctttggctgctgcc
cgtttcttgaagaccgctgatgatactctcatggaggaatttcatgccttctgtgcagcc
caggcgggatggctggaagattacgccctgtatgaagtattgtgcgtccattatggggac
tcccgctggttcacaacatgggacaaggacatagccctgcgcaagcctgacgcgctggtt
tcatggcgtgagaaaaaggctgtcgagctggagaatgccaagatcaggcaatttttcttt
ttccgtcagtggcaggcagtccgttcttatgctcacggcaaaggtatatccatcattgga
gacctgcctatctatgttgcggctgacagtgctgacgcatggagtcatcgtgaactactt
tcgttttctcccgatggtgtgcagacggagctggggggagttccgcccgacgccttctct
gccacggggcagttgtggggtaacccggtgtatgcatgggaaaagcatgaagaagatggt
ttcgcttggtggacacgtcggcttgcggcggctttctcccaagtggatatcctgcggctt
gaccacttccgaggttttgccgcctgctgggtagtaccggcatcggcatctacagccgcc
tccggacgctgggtcgcatctcccggaacccgtttgctcgccgctgcgcgtgagaagctg
ggaaacatggacatcatagcggaggatttgggagtgattactcccgatgtcgagcagttg
cgtgttgaaaacggattccccggcatgaagatcctccaattcgcctttgaaaagaaagat
ggccgcttcaatccccatcatgactatcttccccatgagtatgactatgacagcgcggcc
tataccggaacccatgacaaccagaccagccggggatggttctcctcgctttcccatgag
tacaaggacatggtgaggtgctatcttcaatgtgatgatggggatgtcgtctggcagatg
attcgcgtcatcatgatgagccgtgcccgctatgccgtgttccccatccaggatatcttg
ggatgcggcgatgaagcgcgtttcaatacaccgggaacctgcggtacccataattgggga
tggaggatgaaccccgaagctctgcaaggctggatggtggagagattctcaggcatggtg
acaatgtacggacgttctaccgggcaggcgtaa

DBGET integrated database retrieval system