KEGG   Spirochaeta coccoides: Spico_1622Help
Entry
Spico_1622        CDS       T01469                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
scc  Spirochaeta coccoides
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Butirosin and neomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:scc01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:scc00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:scc00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:scc00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:scc00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:scc00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis [PATH:scc00524]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1920196..1921176
Genome map
AA seq 326 aa AA seqDB search
MIVVGIDIGGTKCAVSLGDVTDATYEIFVKMPVRQTRDYTVQGMLEQCVKDIQSCIAERP
DSPPVAVGISCGGPLDSRHGLILSPPNLPGWDSVPIRDFIASRTGLPTWLCNDANAGALA
EWHYGAGKGCDSMVFLTFGTGLGAGLILDGRLYVGANDMAGEVGHIRLAPTGPPGYGKKG
SFEGFCSGGGIALQAQAHAREWLAEGKKTLLCTDESTITAISARTVGEAAQQGDPLAVSI
MTTVGRKLGLGLSVIMDILNPERIIIGGIFQRSYDYIWPEASRVLAAESLALNAEACTVM
PAALKENIGDVSALISAYYHSKKEWQ
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtagtggggatagacattggtggaacaaaatgtgccgtctcattaggagatgtc
actgatgccacatatgaaatctttgtgaaaatgcctgttcgccaaactcgcgattatacg
gttcaggggatgcttgagcaatgtgtcaaagacatacaatcctgcattgcggaacgaccg
gactcccctcctgttgctgtcggaatcagctgcggagggccgctggattctcgtcacggc
ctgattctttcccctcctaatctccccggatgggattccgtccccatacgggatttcatt
gcttcccggactggcttaccaacatggctttgcaacgatgcaaatgccggagctctcgct
gaatggcactacggagccggtaaaggctgtgattccatggtttttctgactttcgggaca
ggtttgggagccggtttgattttggatggacgcctctatgtcggtgcaaacgacatggct
ggagaggtcggacatattcgtcttgctccgactggccctccaggttatggaaagaaaggt
tcctttgagggtttttgcagtggaggcggaattgctttgcaagcccaggcacacgcaaga
gaatggcttgcggaaggcaaaaaaactctgttatgtactgatgaaagtactatcacagcc
ataagcgcaagaacagtcggtgaagccgcgcagcaaggcgaccccttggccgtgagcatc
atgacaacagtcggcagaaagctcggactgggcttgtccgtgataatggatatcctcaat
cctgaaaggatcatcataggtggcatattccagcgttcatatgattacatctggccggaa
gccagcagagtattggcggcggaatcattggcattgaacgcggaagcttgtactgtcatg
ccggcggcattaaaagaaaatattggtgatgtttccgccttgatttccgcatattatcat
agtaagaaggaatggcaatga

DBGET integrated database retrieval system