KEGG   Sphaerochaeta coccoides: Spico_1622Help
Entry
Spico_1622        CDS       T01469                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
scc  Sphaerochaeta coccoides
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Butirosin and neomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:scc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Spico_1622
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spico_1622
   00052 Galactose metabolism
    Spico_1622
   00500 Starch and sucrose metabolism
    Spico_1622
   00520 Amino sugar and nucleotide sugar metabolism
    Spico_1622
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Spico_1622
   00524 Butirosin and neomycin biosynthesis
    Spico_1622
Enzymes [BR:scc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Spico_1622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1920196..1921176
Genome map
AA seq 326 aa AA seqDB search
MIVVGIDIGGTKCAVSLGDVTDATYEIFVKMPVRQTRDYTVQGMLEQCVKDIQSCIAERP
DSPPVAVGISCGGPLDSRHGLILSPPNLPGWDSVPIRDFIASRTGLPTWLCNDANAGALA
EWHYGAGKGCDSMVFLTFGTGLGAGLILDGRLYVGANDMAGEVGHIRLAPTGPPGYGKKG
SFEGFCSGGGIALQAQAHAREWLAEGKKTLLCTDESTITAISARTVGEAAQQGDPLAVSI
MTTVGRKLGLGLSVIMDILNPERIIIGGIFQRSYDYIWPEASRVLAAESLALNAEACTVM
PAALKENIGDVSALISAYYHSKKEWQ
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtagtggggatagacattggtggaacaaaatgtgccgtctcattaggagatgtc
actgatgccacatatgaaatctttgtgaaaatgcctgttcgccaaactcgcgattatacg
gttcaggggatgcttgagcaatgtgtcaaagacatacaatcctgcattgcggaacgaccg
gactcccctcctgttgctgtcggaatcagctgcggagggccgctggattctcgtcacggc
ctgattctttcccctcctaatctccccggatgggattccgtccccatacgggatttcatt
gcttcccggactggcttaccaacatggctttgcaacgatgcaaatgccggagctctcgct
gaatggcactacggagccggtaaaggctgtgattccatggtttttctgactttcgggaca
ggtttgggagccggtttgattttggatggacgcctctatgtcggtgcaaacgacatggct
ggagaggtcggacatattcgtcttgctccgactggccctccaggttatggaaagaaaggt
tcctttgagggtttttgcagtggaggcggaattgctttgcaagcccaggcacacgcaaga
gaatggcttgcggaaggcaaaaaaactctgttatgtactgatgaaagtactatcacagcc
ataagcgcaagaacagtcggtgaagccgcgcagcaaggcgaccccttggccgtgagcatc
atgacaacagtcggcagaaagctcggactgggcttgtccgtgataatggatatcctcaat
cctgaaaggatcatcataggtggcatattccagcgttcatatgattacatctggccggaa
gccagcagagtattggcggcggaatcattggcattgaacgcggaagcttgtactgtcatg
ccggcggcattaaaagaaaatattggtgatgtttccgccttgatttccgcatattatcat
agtaagaaggaatggcaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system