KEGG   Sphaerochaeta coccoides: Spico_1665Help
Entry
Spico_1665        CDS       T01469                                 

Definition
L-fucose isomerase
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
scc  Sphaerochaeta coccoides
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:scc00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Spico_1665
Enzymes [BR:scc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     Spico_1665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1974873..1976684
Genome map
AA seq 603 aa AA seqDB search
MANKTVGFPRARLAGTWPKIGIRPIIDGRRRGVREALEEQTMNMARSAAALLTENLRYND
GTPVQCVIADSTIGGVAEASRCADKFSRENVSITLSVTPCWCYGTETFDADPNTIKAVWG
FNGTERPGAVYLAAVLAAHSQKGLPAFGIYGHDVQEATDTAIPADVKEKLLRFARAAVAA
ASLRGTSYLAIGGCSMGIAGSVVDQAFLQEYLGMRAEVIDMCEISRRIEENIFDPVEFKM
AKEWVKKNITEAPDKVNPPQWQRSEKQREADWDYCIKMTMITRDLMQGNLKLAEMGFEEE
AEGHNAIASGFQGQRQWTDHWPNGDFMETMLTTSFDWNGIREPYVVATENDHLNGVSMLF
GKLLTGRAQIFSDVRSYWSPESLKRVTGWTPTGRAKDGFIHLINSGATTMDATGQMKDGE
GNSVMKHFWEITEKDVKAVLDNTTFSVANGGYFRGGGFSSTFKTTGEMPVTMCRLNIVKG
LGPVLQIAEGWTCDVPDDVFDIINRRTDPTWPTTWFVPRTDGNDGPFKDVYSVMANWGAN
HGAISYGHIGADLITLASMLRIPVSMHNVPYSEIFRPSTWNAFGSNPEGADFRACATYGP
QFG
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggcaaataaaaccgtcgggtttccacgtgctcgtctggccggcacatggccgaaaatt
ggaatcagacccatcatcgatggccgtcgcagaggcgtgagggaagctcttgaggaacag
accatgaacatggcgcggtcagctgccgcgttgctcactgaaaacctgcgttacaacgat
ggcactccggtacagtgcgtaatagcggacagtacgataggcggagtcgccgaggcgtca
cgatgcgccgacaagttctcacgggagaacgtgagcatcacgctctcggttactccgtgt
tggtgctatggtacggaaaccttcgacgccgacccgaacaccatcaaggccgtatggggt
ttcaacggcacggagagacccggcgctgtctatctggccgccgtccttgccgcccattcc
cagaaagggctgcccgctttcggcatctacggacacgatgttcaggaagcgactgatacc
gccattcccgccgatgtcaaggaaaagctcctccgcttcgcccgtgccgccgtcgccgca
gcttccctccggggaaccagctatctggccataggcggatgctccatgggcattgccggt
tcggtcgtcgatcaggctttcctccaggaatacctgggcatgcgtgccgaggtaatcgac
atgtgcgagatttcccggcgcattgaagagaacatctttgatccggttgaattcaagatg
gcaaaggaatgggtgaagaagaacatcaccgaggctccggacaaggtgaaccctccacaa
tggcagcgttccgagaagcagcgggaggccgattgggactattgtatcaagatgaccatg
attacccgcgacctgatgcaaggcaacctgaagctcgcggagatgggttttgaggaagaa
gccgagggtcacaatgcaatcgccagcggtttccagggacagcgacagtggacggatcat
tggccgaacggagactttatggagactatgctcaccacatcgttcgactggaacggaatc
cgcgaaccctatgtggtagccacggagaatgatcatctcaatggtgtatccatgctcttt
ggcaagctcctgaccggtcgcgcccagattttcagcgatgttcgttcttactggagtcca
gagtcattgaagcgagtcaccggatggacgcccaccggccgcgcaaaggatggtttcatc
catttaatcaacagcggcgcgaccacgatggatgctacgggacagatgaaggacggtgaa
ggcaattccgtgatgaaacacttctgggagattacggaaaaggatgtcaaggctgtcttg
gacaatacaacgttcagcgtagccaacggtggttatttccgtggtggtggtttcagctcc
acgttcaagactaccggagaaatgcctgtgaccatgtgccgcctgaacattgtcaagggt
ctggggcctgtgctccagattgccgaaggatggacgtgtgatgtgcccgacgatgttttt
gatatcatcaaccggcgcacagatcctacgtggcctactacatggttcgtaccccgcact
gatggaaatgacggtcctttcaaggatgtatattctgtcatggcgaactggggagcgaac
cacggcgctatcagctacgggcatatcggagccgacttgattacgttggcttccatgcta
cgcattccggtgagcatgcacaatgtcccctactcggagattttccggccaagcacatgg
aacgcattcggcagcaatcctgaaggggcggacttccgagcgtgtgccacatacgggcct
cagttcggttga

DBGET integrated database retrieval system