KEGG   Sphaerochaeta coccoides: Spico_1788Help
Entry
Spico_1788        CDS       T01469                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
scc  Sphaerochaeta coccoides
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:scc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Spico_1788
   01230 Biosynthesis of amino acids
    Spico_1788
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spico_1788
   00030 Pentose phosphate pathway
    Spico_1788
   00051 Fructose and mannose metabolism
    Spico_1788
   00052 Galactose metabolism
    Spico_1788
  Energy metabolism
   00680 Methane metabolism
    Spico_1788
Enzymes [BR:scc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Spico_1788
Protein phosphatases and associated proteins [BR:scc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Spico_1788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2113925..2115253)
Genome map
AA seq 442 aa AA seqDB search
MSSAVLDFTIPNLGEAKIPSPILMSHSSGDGMADYVLDSTRILFNVATKAGSDGHSVPVD
DGTLELAGPRERIYFNPAHVHAAITTCGGICPGLNNVIRAVVRCFWYRYGVRRISGIPYG
YQGLLEESSFPIIPLDPDIVDDIQEKGGTILGSSRGGGDQISEIVDSLERMNVNILVAVG
GDGTLRGAWDIGEEIKKRGLKISVIGVPKTIDNDLSFIQSSFGFDTAVAQAVPVVRGAHI
EARNSINGIGLVKVMGRESGFIAANTSLAQSDVNFCLIPENPFDLEGENGFLVHLKKRIL
DRGHAVILLAEGAGQNLLPPTAERDASGNVKFQDIGIFLKDRIQAYFKKERIEVNIKYID
PSYIIRSAPADSFDSIYCARLGAHAVHAAMAGKTQALISQWNNKYVHIPIKVAVSRRNHI
DLEGTLWRDVLENTRQPYSMAN
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtgcagttttagactttactataccgaatcttggagaggcaaagataccttct
cccattctgatgagccatagctccggagatggcatggccgactatgtgcttgactccacc
cgaatcctgttcaacgtggcgaccaaggctggttctgacggtcattccgttcctgtggat
gatggtaccctggagcttgcaggcccccgtgagcgcatctatttcaaccctgcccatgtc
catgcggccattactacctgcggtggtatctgtcccggtctgaacaatgtaatcagggcg
gtggttcgatgtttctggtatcgctacggcgtgcgccgcatcagcggcatcccctatgga
taccaaggtctgctggaggagtcttcctttcctatcatcccccttgatccggacattgtc
gatgacattcaggagaagggcggaaccatcctcggttcctcacgcggtggtggtgatcag
atttccgaaatcgtagattcgctggagaggatgaacgtcaacatcctggtggcggtcgga
ggggacggaaccttgcggggagcctgggatattggggaagaaatcaagaagcgcgggctg
aagatatcggtcatcggcgtgccgaagacaatagataatgatctttcgttcatccagagt
tcctttggttttgatacagctgtcgctcaggcggttcctgtggtgcgtggggcgcatatc
gaggcacgcaattctatcaacggcattggcctggtcaaagtgatgggcagggagtccggt
ttcatagccgccaatacatccctggcgcagagtgatgtcaatttctgtctgattcctgag
aatccgtttgacctggagggggagaatgggttccttgtccacttgaagaaaaggattctg
gatcgtgggcatgctgtcattttgcttgccgagggagcaggtcagaacctgttgcctccc
actgcggaaagggacgcttccggcaacgtgaagtttcaggatatcggcatattcctcaag
gatcgcatccaggcttatttcaagaaggaacgcatagaggtgaacataaagtatattgat
cccagctacatcatccgcagcgcacccgctgattcctttgattccatctactgtgcccgg
cttggcgcccatgctgtccatgcggcaatggcggggaagacgcaggcgttaatcagtcaa
tggaacaacaagtatgtccacattcccatcaaggtggcggtcagccgacgcaaccacatt
gatttggaagggacgttgtggcgcgatgttctggagaatacgcgccagccatattccatg
gcaaactga

DBGET integrated database retrieval system