KEGG   Spirochaeta coccoides: Spico_1841Help
Entry
Spico_1841        CDS       T01469                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
scc  Spirochaeta coccoides
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:scc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2191594..2192184
Genome map
AA seq 196 aa AA seqDB search
MNTLDNLIQALSRLPGIGPKSAARIGYHLIKTNPQYNKELAKSIGTIQDVVFPCPVCGSY
TEISPCRFCSDSSRDRELLCVVEQPQDVVTISTSGSYNGLYHVLGGAISPLDGIGPEDLS
FDSLMRRISEGSFQEVIIATNPTEEGDTTAMYIRHLMKDFPDIILTRLASGLPIGGDLEY
ADRLTLARSLRGRIKF
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccctggacaatctcatccaagcattgagccgtttgcccggcatcggccccaag
agcgcagcccgcatcggctaccacctgataaagacaaatccccagtataacaaggaactg
gcaaaaagcatcgggactatccaggatgtcgttttcccttgtcctgtctgcggcagctac
acggagatatctccctgccggttctgctctgactcatcgcgggacagagaacttctttgc
gtggtggaacaaccgcaggatgtagtgacgatcagcacgtccggctcatacaacggcctg
taccatgtccttggcggggcaatcagtcccttggatggcataggaccggaagacttgagt
ttcgattccttgatgcgccgcatttccgaaggttccttccaagaggtcatcatagccacg
aatcctaccgaggaaggggatactacggccatgtatatccgtcacctgatgaaagatttt
cctgatatcatcctgacacggttggcttccggactgccaatcggcggagacttggaatat
gccgaccgcctcactctcgcccgttccctccgcggacgcatcaagttctga

DBGET integrated database retrieval system