KEGG   Treponema caldaria: Spica_0177Help
Entry
Spica_0177        CDS       T01573                                 

Definition
Tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
scd  Treponema caldaria
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:scd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Spica_0177
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spica_0177
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Spica_0177
Enzymes [BR:scd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Spica_0177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
200479..201771
Genome map
AA seq 430 aa AA seqDB search
MKSEAGYFGPYGGRYVPEVLLRAIQEIETTFYEAMKDEAFIRELERLRYEFIGRPTPLLY
AEHTSKLLGGADLFIKMEGLAHTGAHKINNAIGQVLLAKRMGKKRIIAETGAGQHGLATA
AACAKLGLPCTVYMGSVDVDRQQPNVATMELFGAQVVPVESGSQTLKDAINEAFRDWAAS
FEDTFYVIGSALGPAPYPDMVRTFQSVVGREVQQQLAEFGRTPDALVACVGGGSNAIGFF
EPYLDQEVPRLIGVEAGGRGPEPGNHAARMTGEGARTGIVHGYKSRFLLTEDGQVGQTHS
ISAGLDYPGIGPQLAALGRSGRLEFRRATDQESLEALQFFARNEGVIFALESAHAGAAAI
NLTRSLPKGKTVVVNMSGRGDKDLFITAPLLRPREWEAFLQRELEALEVQRAAGIAQAGS
GQSDNGQGGK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcgaagctggttactttggaccctatggggggcgctatgtacctgaggtgctc
ctgcgggccattcaagaaatagaaacgaccttttatgaggccatgaaggatgaggctttt
atccgggaactggaacggctgcggtacgagtttattgggaggccgacgccgcttctctat
gcggaacataccagtaaactgcttggcggggcagatctgtttatcaaaatggaagggctg
gcccacaccggcgcccataagattaataatgccatagggcaggttttgctggccaagcgg
atgggtaaaaaacggattattgccgaaaccggtgcgggccagcacggccttgcaacggcg
gcggcctgcgccaaactgggactcccctgcaccgtctacatgggctcagtcgatgtggac
cgtcaacagcccaatgtggccaccatggaactcttcggtgcccaggtggtgccggtagaa
agcggttcccaaaccctgaaggatgcgataaatgaggctttccgggactgggctgcctca
tttgaggataccttttatgttattggcagtgccctgggccccgccccctacccggatatg
gtgcgaacctttcagtccgttgttggccgggaagtacagcagcagcttgccgaatttggc
cgtacccccgatgccctggtggcctgtgtgggcggcggttccaatgcgatcggctttttt
gagccctatctggaccaggaggtgccccggcttatcggtgtagaagcgggggggcggggc
cccgaaccgggaaaccatgcggcccgaatgaccggtgaaggtgcccgtactggtattgta
catggttacaagagccgcttcctgctcaccgaagacggccaggtgggccagacccactcc
atatcagcgggattggactaccccgggatcgggccccagctggcggccctgggccgctcg
ggccgtctggaattccgccgggctacagaccaggaatccttggaagctctgcagttcttt
gctcggaatgaaggtgtcatctttgctctggaaagcgcccatgccggagcggcggccatc
aacctgacccgttcccttccgaagggcaagacggtggtggtaaatatgtccggccggggc
gacaaggacctttttatcaccgccccgctcctgcggccccgggaatgggaagccttttta
cagcgggaactggaagctctggaagttcagcgggcggctggtattgctcaggctggcagc
ggccaatctgacaatggacagggaggcaagtaa

DBGET integrated database retrieval system