KEGG   Treponema caldaria: Spica_0177Help
Entry
Spica_0177        CDS       T01573                                 

Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
scd  Treponema caldaria
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:scd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Spica_0177
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spica_0177
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Spica_0177
Enzymes [BR:scd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Spica_0177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
200479..201771
Genome map
AA seq 430 aa AA seqDB search
MKSEAGYFGPYGGRYVPEVLLRAIQEIETTFYEAMKDEAFIRELERLRYEFIGRPTPLLY
AEHTSKLLGGADLFIKMEGLAHTGAHKINNAIGQVLLAKRMGKKRIIAETGAGQHGLATA
AACAKLGLPCTVYMGSVDVDRQQPNVATMELFGAQVVPVESGSQTLKDAINEAFRDWAAS
FEDTFYVIGSALGPAPYPDMVRTFQSVVGREVQQQLAEFGRTPDALVACVGGGSNAIGFF
EPYLDQEVPRLIGVEAGGRGPEPGNHAARMTGEGARTGIVHGYKSRFLLTEDGQVGQTHS
ISAGLDYPGIGPQLAALGRSGRLEFRRATDQESLEALQFFARNEGVIFALESAHAGAAAI
NLTRSLPKGKTVVVNMSGRGDKDLFITAPLLRPREWEAFLQRELEALEVQRAAGIAQAGS
GQSDNGQGGK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcgaagctggttactttggaccctatggggggcgctatgtacctgaggtgctc
ctgcgggccattcaagaaatagaaacgaccttttatgaggccatgaaggatgaggctttt
atccgggaactggaacggctgcggtacgagtttattgggaggccgacgccgcttctctat
gcggaacataccagtaaactgcttggcggggcagatctgtttatcaaaatggaagggctg
gcccacaccggcgcccataagattaataatgccatagggcaggttttgctggccaagcgg
atgggtaaaaaacggattattgccgaaaccggtgcgggccagcacggccttgcaacggcg
gcggcctgcgccaaactgggactcccctgcaccgtctacatgggctcagtcgatgtggac
cgtcaacagcccaatgtggccaccatggaactcttcggtgcccaggtggtgccggtagaa
agcggttcccaaaccctgaaggatgcgataaatgaggctttccgggactgggctgcctca
tttgaggataccttttatgttattggcagtgccctgggccccgccccctacccggatatg
gtgcgaacctttcagtccgttgttggccgggaagtacagcagcagcttgccgaatttggc
cgtacccccgatgccctggtggcctgtgtgggcggcggttccaatgcgatcggctttttt
gagccctatctggaccaggaggtgccccggcttatcggtgtagaagcgggggggcggggc
cccgaaccgggaaaccatgcggcccgaatgaccggtgaaggtgcccgtactggtattgta
catggttacaagagccgcttcctgctcaccgaagacggccaggtgggccagacccactcc
atatcagcgggattggactaccccgggatcgggccccagctggcggccctgggccgctcg
ggccgtctggaattccgccgggctacagaccaggaatccttggaagctctgcagttcttt
gctcggaatgaaggtgtcatctttgctctggaaagcgcccatgccggagcggcggccatc
aacctgacccgttcccttccgaagggcaagacggtggtggtaaatatgtccggccggggc
gacaaggacctttttatcaccgccccgctcctgcggccccgggaatgggaagccttttta
cagcgggaactggaagctctggaagttcagcgggcggctggtattgctcaggctggcagc
ggccaatctgacaatggacagggaggcaagtaa

DBGET integrated database retrieval system