KEGG   Spirochaeta caldaria DSM 7334: Spica_0178Help
Entry
Spica_0178        CDS       T01573                                 

Definition
Tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
scd  Spirochaeta caldaria DSM 7334
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:scd01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:scd00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:scd00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
201771..202583
Genome map
AA seq 270 aa AA seqDB search
MQPITLMAHLVANYPDPSGCLAAAEALVEAGTRYLEVQIPFSDPSADGRSIMNACAATLE
AGFSVADAFHLVQELKGRYPQIPLFVMAYANLVVSPGVDAFVHRLHQAGVSGLIVPDLPF
DRDEGLAAACAAYTEPVISAIPVAAPSMSRERLINMVSLGRPYLYAALRTGITGQATEIA
DSTKEFLALCGSGGSKVLGGFGIRSHAQALQVADHVHAVVAGSVFVDAISKAVEAHGVVR
NGSFRGSSRVRDEAIRNLVREQVLEIIQGA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccgattactcttatggcccatctggtggccaattatccagacccttcgggctgt
cttgcagcagccgaagccctggtagaggctggtacgaggtatcttgaggtgcagattccc
ttcagtgatcccagtgcggatgggcgaagcattatgaatgcctgtgcggcaacgctggag
gcgggtttttcggtcgccgatgcgttccacctggttcaggagcttaaggggcgctatcct
cagattcctctttttgttatggcctatgctaaccttgtggtaagtcccggtgtggatgcc
tttgtgcaccggctgcatcaggccggagtatccgggctcattgtgccggaccttcccttt
gatagggatgaggggcttgcggcagcctgtgccgcctatactgagccggtcatttctgcg
atccctgtggctgccccctctatgagccgggagcggctcatcaatatggtatccctgggt
cgtccctatctatatgcggcactccgtacggggattaccggtcaggcaacggaaattgca
gacagtacgaaggaattccttgccctctgcgggagtggcggttcaaaggtgttagggggc
tttggaattcgcagtcatgcccaggctttgcaggtagcagaccatgtgcatgctgtggtg
gccggttctgtctttgtggatgccatctccaaggcggtggaagcccatggtgtggtgcgg
aatggcagtttccggggctcaagccgggtccgtgatgaggcaatacggaacctggtgcgg
gaacaggtcctggaaattattcagggagcatag

DBGET integrated database retrieval system