KEGG   Treponema caldarium: Spica_0178Help
Entry
Spica_0178        CDS       T01573                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
scd  Treponema caldarium
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:scd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Spica_0178
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spica_0178
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Spica_0178
Enzymes [BR:scd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Spica_0178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
201771..202583
Genome map
AA seq 270 aa AA seqDB search
MQPITLMAHLVANYPDPSGCLAAAEALVEAGTRYLEVQIPFSDPSADGRSIMNACAATLE
AGFSVADAFHLVQELKGRYPQIPLFVMAYANLVVSPGVDAFVHRLHQAGVSGLIVPDLPF
DRDEGLAAACAAYTEPVISAIPVAAPSMSRERLINMVSLGRPYLYAALRTGITGQATEIA
DSTKEFLALCGSGGSKVLGGFGIRSHAQALQVADHVHAVVAGSVFVDAISKAVEAHGVVR
NGSFRGSSRVRDEAIRNLVREQVLEIIQGA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccgattactcttatggcccatctggtggccaattatccagacccttcgggctgt
cttgcagcagccgaagccctggtagaggctggtacgaggtatcttgaggtgcagattccc
ttcagtgatcccagtgcggatgggcgaagcattatgaatgcctgtgcggcaacgctggag
gcgggtttttcggtcgccgatgcgttccacctggttcaggagcttaaggggcgctatcct
cagattcctctttttgttatggcctatgctaaccttgtggtaagtcccggtgtggatgcc
tttgtgcaccggctgcatcaggccggagtatccgggctcattgtgccggaccttcccttt
gatagggatgaggggcttgcggcagcctgtgccgcctatactgagccggtcatttctgcg
atccctgtggctgccccctctatgagccgggagcggctcatcaatatggtatccctgggt
cgtccctatctatatgcggcactccgtacggggattaccggtcaggcaacggaaattgca
gacagtacgaaggaattccttgccctctgcgggagtggcggttcaaaggtgttagggggc
tttggaattcgcagtcatgcccaggctttgcaggtagcagaccatgtgcatgctgtggtg
gccggttctgtctttgtggatgccatctccaaggcggtggaagcccatggtgtggtgcgg
aatggcagtttccggggctcaagccgggtccgtgatgaggcaatacggaacctggtgcgg
gaacaggtcctggaaattattcagggagcatag

DBGET integrated database retrieval system