KEGG   Treponema caldaria: Spica_0199Help
Entry
Spica_0199        CDS       T01573                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
scd  Treponema caldaria
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scd00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Spica_0199
Enzymes [BR:scd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Spica_0199
Exosome [BR:scd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Spica_0199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(225969..227465)
Genome map
AA seq 498 aa AA seqDB search
MAITQQYILALDQGTTTSRAILFNHSGAVIALCQKPFRQIYPQGGWVEHDPEEIWKTQYE
AAQEAIEQAQITAEQIAAIGITNQRETTLLWERKTGKPVYNAIVWQCRRSADLCRELKAL
GYTDVIREKTGLVLDPYFSATKLMWLFQEIPGLKTRAEAGELCFGTIDSWLLYKLTGKHL
TDVTNASRTLLFNIKSLQWDEDLLKIFGIPKQIVPEVLPSSGFLANTKPELFGKSIPITG
CAGDQQAALFGHACFSPGSVKNTYGTGCFALLNTGTTPISSQNNLLTTIAWKIGGSTTYA
LEGSVFIGGAVIQWIRDELKLINNAAESESLAKSVDSTGGVFVVPAFVGMGAPYWDPDVR
GTIVGLTRGSNRAHLVRAALESIAFQSRDLIDAMESDYGHPIQELKADGGAAANSFLMQY
QSDILGKAVILPEVMEITALGAAYLAGLEVGYWDSLRDIEVNWRVRRRFQPSMNPDTREQ
LLNQWHHAIDVARSYHTL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggccataacacagcaatacattcttgccctcgatcaagggacaaccacatcccgggcg
atactcttcaatcatagcggggctgttattgcgctctgtcagaaaccgttccgccaaatt
tacccccagggcggttgggtggagcatgatccggaagaaatttggaaaacccagtacgaa
gctgctcaggaagcaatagaacaagctcagattaccgcagaacaaattgcagccataggg
attaccaaccagcgtgaaaccaccttgctctgggaacgaaaaaccgggaaaccggtttat
aatgcaatcgtctggcagtgtcgccgtagtgcagacctctgcagagaacttaaagccctg
ggatataccgatgtaatccgagaaaaaactgggcttgtcttagatccctatttttctgct
accaaattaatgtggcttttccaggaaatacctggacttaaaacccgtgcggaagcaggg
gaactttgttttgggaccatcgactcatggcttctctacaaactgacaggaaaacatctt
accgatgtaaccaatgcctccagaacgcttctgtttaatattaaatcgctgcaatgggat
gaggatctcctcaaaatctttggtatacccaaacaaattgtacctgaggttctgccatct
tcaggattccttgcgaacaccaagccggaacttttcgggaaaagtattcccattacagga
tgcgccggagaccaacaggctgccctttttggacatgcctgtttcagccccggttcggta
aaaaacacttatggaaccggctgttttgccttgctcaatacggggactacccctatttca
tcccaaaataatctgcttaccactattgcatggaagatcggcggatcaaccacctatgcc
cttgaaggaagcgtttttattggcggtgcggttatccagtggatccgggatgaactaaag
ctgatcaataatgctgcagagtccgaaagtctagcaaagtcagtagattccaccggtggg
gtttttgttgttcctgcctttgttggcatgggagccccctattgggaccccgacgtacgg
ggaaccatcgtcggccttaccagaggcagtaaccgggctcaccttgttcgagctgccctc
gaaagtatcgcattccagtcccgggatttaattgatgcaatggaaagtgattatggccac
ccgattcaggaactgaaggcagatggtggtgctgcggcgaactcttttctcatgcagtat
caatcggatatattgggtaaagcggtgattctaccagaggttatggaaataaccgccctg
ggagcagcatatctggcgggtctcgaagtcggttactgggacagtttacgggatattgaa
gtaaattggcgggttcgacgacgcttccaaccaagcatgaatcctgatacccgggagcaa
ctattgaaccaatggcatcatgctatcgatgttgcccgcagttatcatacattataa

DBGET integrated database retrieval system