KEGG   Treponema caldaria: Spica_0201Help
Entry
Spica_0201        CDS       T01573                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
scd  Treponema caldaria
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:scd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Spica_0201
DNA repair and recombination proteins [BR:scd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Spica_0201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(229261..229848)
Genome map
AA seq 195 aa AA seqDB search
MNAIDRLVGLLTKLPGIGKKTAGRLAYFILDADPSYARQLAEELQSLHSHIRRCSVCGSF
TETDPCTICTDPGRDQHILCVVERAQDVRVIEEGHEYRGRYHVLGGLIAPLDGIGPEKLA
IGQLVNRIHRGGITEVILALNPTVEGDTTALYLHKILKETGVQVSRLASGLPVGGDLEYA
DRLTLSRSFRGRIPM
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctatcgatcgcttagtgggcctcttgaccaaacttccgggaatcggaaaaaaa
actgcaggacggctcgcttattttatactcgacgctgatccaagttatgcccgacaattg
gctgaagaactccagagtctccacagtcatattcgacgctgttctgtctgcggcagtttt
acggaaactgacccctgcaccatctgcactgatccggggagagatcagcatatactctgc
gttgtggaacgggctcaggatgtgcgggttatcgaggaagggcatgaatatcgggggcgc
taccatgtgcttggtgggcttattgcgccgttggatggcatcggcccagaaaaactcgct
atcggccaattagtaaaccgtattcaccgcggaggcattactgaggttattttggcttta
aatcccaccgtggaaggggacactaccgctctatatttacacaagattttaaaagaaaca
ggtgtacaggtatctcgccttgcttcgggacttcctgtcgggggcgatctggaatatgca
gatcggctaaccctttcacgcagtttccgcggccgaattcccatgtag

DBGET integrated database retrieval system