KEGG   Spirochaeta caldaria DSM 7334: Spica_0201Help
Entry
Spica_0201        CDS       T01573                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
scd  Spirochaeta caldaria DSM 7334
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:scd03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(229261..229848)
Genome map
AA seq 195 aa AA seqDB search
MNAIDRLVGLLTKLPGIGKKTAGRLAYFILDADPSYARQLAEELQSLHSHIRRCSVCGSF
TETDPCTICTDPGRDQHILCVVERAQDVRVIEEGHEYRGRYHVLGGLIAPLDGIGPEKLA
IGQLVNRIHRGGITEVILALNPTVEGDTTALYLHKILKETGVQVSRLASGLPVGGDLEYA
DRLTLSRSFRGRIPM
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctatcgatcgcttagtgggcctcttgaccaaacttccgggaatcggaaaaaaa
actgcaggacggctcgcttattttatactcgacgctgatccaagttatgcccgacaattg
gctgaagaactccagagtctccacagtcatattcgacgctgttctgtctgcggcagtttt
acggaaactgacccctgcaccatctgcactgatccggggagagatcagcatatactctgc
gttgtggaacgggctcaggatgtgcgggttatcgaggaagggcatgaatatcgggggcgc
taccatgtgcttggtgggcttattgcgccgttggatggcatcggcccagaaaaactcgct
atcggccaattagtaaaccgtattcaccgcggaggcattactgaggttattttggcttta
aatcccaccgtggaaggggacactaccgctctatatttacacaagattttaaaagaaaca
ggtgtacaggtatctcgccttgcttcgggacttcctgtcgggggcgatctggaatatgca
gatcggctaaccctttcacgcagtttccgcggccgaattcccatgtag

DBGET integrated database retrieval system