KEGG   Spirochaeta caldaria DSM 7334: Spica_0225Help
Entry
Spica_0225        CDS       T01573                                 

Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
scd  Spirochaeta caldaria DSM 7334
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:scd00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:scd00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
255390..256673
Genome map
AA seq 427 aa AA seqDB search
MHEYLIEGGKPLSGTITASGNKNAALPCIAAALLTDQPVVLKNIPAIEDVQVMLEVYKAL
GGTVEPIGHNAYRLTVTNIVSDEIPVAQAKKIRASILFAGPMLARNGRVVLPPPGGDVIG
RRRLDTHFLALTELGAQVEINGSFVFTASRLQGADIFLDEASVTATENAIMAAVLAKGRT
LLTNAASEPHVQDLCKMLVSMGARISGIGSNVLTIDGVERLSGTEFAIGADFMEVGSFIG
LAAATRSELTITNTRPEDLRPAKIAFGKLGIQWEVDGTTIHISKQQSLKVNTDLGGMIPK
IDDAPWPGFPPDLTSIITVVATQVEGTVLIHEKMFESRMFFVDKLIGMGARIVLCDPHRA
VVTGPARLTGSELTSPDVRAGMAMVIAALAAEGKSLIRNVYQIERGYEHLVDRLATLGAN
IKRINEC
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaataccttatagaaggcggaaagcccctttcaggaaccataaccgccagtgga
aataaaaatgcagcccttccctgtattgctgcagccctcttaaccgatcaaccggtcgtt
ttaaaaaatatacccgctatcgaagatgtccaggtcatgctggaagtctacaaagctctt
ggtggaaccgtggagcccatcgggcacaatgcataccggctcactgtgacgaatatagtg
agcgatgaaattcctgtagcccaggcaaaaaagatccgggcttccattctctttgccggc
cccatgcttgcccgtaacggccgggtggttctgccacctcccggcggtgatgttatcggc
cgtcgccggctcgatacccacttcctggcccttaccgaactgggcgcccaggtagagata
aacggttcctttgtatttacagcatctcgtctgcaaggggccgacatcttcctggatgaa
gcctcggtaaccgccaccgaaaacgcaatcatggctgcggtgctcgcgaagggccgcacc
cttctcaccaatgcggccagtgaaccccatgtgcaggatctctgtaagatgctggtatcc
atgggtgctcgcatatcagggattggttccaatgtgctcaccatcgatggggtcgagcgg
ctttcaggcaccgaatttgccatcggtgctgactttatggaagttggttcctttataggc
cttgctgcagccaccaggagcgaacttaccatcaccaatacccgtcctgaggatttacgg
cctgcaaagatagcctttggcaaactcgggattcagtgggaggttgatggaactacaatc
catatttctaaacagcaatcccttaaggtgaataccgatttgggcggtatgataccgaaa
atcgatgatgctccatggccaggctttccgccggatttaaccagtatcattactgtcgtc
gcgacccaggtggaaggcactgtgcttatccatgaaaagatgttcgagtcccgtatgttt
tttgtggataagttaattgggatgggagcccggattgtactttgtgatccccatcgggct
gttgtcaccggtcctgcccgacttacgggatcggagcttacttctccggatgtgcgggct
ggcatggctatggtcattgcagcccttgcagcagagggaaagagccttatccgtaatgtg
taccagattgaacggggatatgaacacctggtggatcgccttgctactctgggtgcgaat
atcaagcggattaacgagtgttaa

DBGET integrated database retrieval system