KEGG   Treponema caldaria: Spica_0244Help
Entry
Spica_0244        CDS       T01573                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
scd  Treponema caldaria
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:scd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Spica_0244
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spica_0244
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Spica_0244
Enzymes [BR:scd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Spica_0244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
274891..276282
Genome map
AA seq 463 aa AA seqDB search
MKYYSTRDKTTAVPFSVAALNGLAADGGLFIPQEIPQFAPAVKNSLGSMGFADIAFETIR
PYVHEDIPDSVLGNMVESAFTFSAPLVPVHDRFMLELFHGPTAAFKDFGARFMARCFAYL
RRNEDRELHILVATSGDTGGAVADGFYGVEGIRVTVLYPKGRVSPLQERQIAGLGGNVSA
IAVEGSFDDCQRLVKSAFVHPELNRKMNLSSANSINISRLLPQAVYYVAASGLAKSGRYS
EDGQATPRLRGKAEEQQVVRDGRLGKDVLFCVPSGNFGNLTAGLYAQAMGAPIAGFIAAT
NINKTVPAYLASGVYEPRSSVATISNAMDVGAPSNFERMTAHWSYEDLRATISGFWVDDD
KTRLTIQRVFDQTGYVLDPHGAVGWNAVDQWIHTKTDPENHLHGFSGPVVVLGTAHPAKF
AETVEPLVGSVPVPPSLAQAMERTVQSVTIRADVSALVETLLS
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaagtattacagcacccgtgacaaaacaactgccgtgcccttttctgtggccgccctc
aatggtcttgctgccgatggcgggctctttataccccaggaaattcctcagtttgcgccg
gcagttaaaaactccctcggttctatgggttttgccgacatcgcctttgaaacgatcagg
ccctatgtgcatgaggatatccccgattcggttctggggaatatggttgagtcggccttt
accttttccgcaccccttgtgccggtccatgaccgttttatgcttgaactgtttcatggt
cctacggcggcctttaaggattttggcgcccgctttatggcccgttgttttgcctatctc
aggcgtaatgaggaccgggaactgcatatccttgtggcaacttcgggggataccggcggt
gctgtggctgacggtttttatggtgtggaaggtattagggtgacggttctgtaccccaag
ggccgggtaagcccgctgcaggagcggcagattgccggtctcggcggcaatgtctcggct
attgcggtagaaggcagttttgatgattgtcagcggctcgtaaaaagcgcctttgttcat
cccgaactgaaccggaaaatgaacctttcctcggcgaattccatcaatatatcccgactt
cttcctcaggcagtgtactatgtcgccgcttcaggcctcgcaaaatcgggtcgctatagc
gaagatgggcaagctacaccgcggcttcgggggaaggcggaggaacagcaggtagttcgg
gatggcaggctgggcaaggatgtgctcttctgtgttcccagcggtaactttggtaacctt
accgccggtctctatgcccaggccatgggggctcccattgcgggctttattgcggctacg
aacatcaataaaacggtgcctgcatatctggcttcgggggtctatgagccccggtcttcg
gtggctaccatttccaatgccatggatgtgggagcccccagtaattttgagcggatgacc
gcccattggtcctatgaagaccttcgcgccactatcagcggtttctgggtggatgatgat
aaaaccagattgacaatacaacgggtttttgaccagactggctatgtcctcgatccccat
ggtgcagtgggctggaatgcggttgatcagtggatacatacaaaaacagatcctgaaaac
cacttgcatggcttctcaggacctgtggtagttcttggaacggcccatccggccaaattt
gctgaaaccgtggaacccctcgtgggctccgtaccggttcctccatcccttgctcaggca
atggagcgaaccgtacaatcggttaccatcagggccgatgtgtcagccctggtggaaacc
ctcttgagctag

DBGET integrated database retrieval system