KEGG   Spirochaeta caldaria DSM 7334: Spica_0299Help
Entry
Spica_0299        CDS       T01573                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
scd  Spirochaeta caldaria DSM 7334
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:scd00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:scd00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:scd00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
338080..340410
Genome map
AA seq 776 aa AA seqDB search
MAIVWHPDTREFHLQNSYVSYIISLLPDNSPGLAYFGRPLDLEGRYSRLVRFEDRGLTTH
QSGLPSSFCLDYVPREYPTYGRGDYRIPAITLETEHGFPVILDLQYREHWIVQGKPSVPG
LPATYCDSDAEAESLMLTLEDPSYQVQVDVHYTIFRDYPVIARRASIRNGGVQALRILRA
YSAVLDLDSSDWDFIHFSGAWARERHVVRRPLAPGLQSIASSRGSSSAQHNPAIMLARRE
ATETAGEVLGALLVYSGNHSIEVEVGSHGDTRIALGINPFGFKWNLSPGDVLETPEALFC
YTDHGFGDLSLSMHQLLGRHLVRGWWRDRERPILINNWEATYFQFDEQKLLDIARSAKDL
GIELFVLDDGWFGKRNDDRSSLGDWEVNRDKLPQGIEGLACKIVDMGLSFGLWIEPEMVN
PDSNLYRQHPDWAVGSILERRTLGRNQLVLDMSRLEVVEYLYDTLSQLLSQVPISYIKWD
MNRHITEPVSAALPADRQGEFFHRYMLGVYELYRRLTEAFPRVLFESCSAGGNRFDAGML
AFAPQAWASDDSDAIERLAIQWGTSFFYPPSAIGAHVSAVPNHQVGRITPLWTRAGVAFF
GAFGYELDPNKLSESDKAEIRAQVDFYKAWRRVFQFGRFYRLAGFCAAGGATGGMTGGPA
GTGQGWPGSRPAGNSNLVAWMSVSEDSRRAVVLIVQVLARPNPGFYRIPLRGLDPDLSYQ
VRCRPALPVKDEAAIRYNEGLRQGDELINVGLLLGGDGWNGLSRGDFASWLFTLEG
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atggcaatagtatggcatccggatactcgggaatttcatctacagaacagttatgtcagt
tatattatttcacttcttcccgataatagtcctggccttgcttattttggtagacctcta
gatctggaaggccgctacagccgtcttgtgaggttcgaagaccggggcctgacaacccat
caatccggactcccttcatcattctgtctcgattatgtaccccgggaataccctacttat
ggccggggagattatcgtataccggctattactttggaaacagaacacggctttcctgtc
atcctcgatctccagtatcgggaacactggattgtgcagggaaaaccatccgtgccaggg
cttcccgctacatactgcgattctgatgcagaggccgagagccttatgctaaccctggaa
gacccctcataccaggttcaggttgatgtgcactataccatctttagggattatcctgtt
attgcccgccgggcaagcatccgtaatggcggggtccaggccttgcgtatcctgcgggcc
tattcggccgtactggacctggattcctctgattgggactttattcatttttccggggcc
tgggcccgggagcggcatgtggtacgcagacccctcgccccgggcttgcagagtattgcc
agcagtcggggaagctccagcgcccagcacaacccggcaatcatgcttgcccggcgggag
gccaccgaaaccgcaggggaggtcctgggcgccctcttagtctattcggggaaccacagc
atcgaagtggaggttggatcccatggggacaccaggatcgccctgggcatcaatcccttt
ggttttaagtggaacctctcccccggcgacgttttagagacaccggaagcgctcttctgt
tataccgaccacgggttcggagacctgtcgctctcaatgcatcagctgttgggccgtcat
ctggtgcggggatggtggcgggatcgggaacgacccatactcatcaataattgggaagcc
acttatttccagtttgatgaacagaaactgctcgatatcgcccgctctgcgaaggatttg
ggcattgagctttttgttttggatgatggctggtttggcaagcggaacgatgaccggagt
tccctgggggactgggaagtaaaccgggataaattaccccagggcatcgaagggctggcc
tgtaaaatcgtcgatatggggttatccttcgggctctggatagagcctgagatggtgaac
cccgacagcaatttgtaccgtcagcatccggactgggcggtgggctctatattggaacgg
cgtaccctggggagaaaccagctggtgctggatatgtccaggcttgaggtggtggagtac
ctctatgacaccctaagccagcttctgtctcaggtccccatatcgtatatcaaatgggac
atgaaccggcatattacggagccggtttccgccgctctgccggctgaccggcagggagag
ttttttcatcgatatatgttgggggtctatgagctgtatcggagacttacagaagctttt
ccccgggtcctctttgaatcctgttctgccggcggaaaccggttcgacgcgggcatgctc
gccttcgcacctcaggcctgggccagcgatgatagcgatgccatagagcgccttgcgatt
cagtgggggaccagttttttctatccgccgagtgccataggtgcccatgtatcggcagtg
ccgaatcatcaggtgggccgcataactcccctctggactcgagcgggtgtagcctttttc
ggtgcctttggctatgagctcgatccgaacaaactttctgagtcagacaaggcagagatt
cgtgcccaggttgatttttataaggcctggcggcgggtgtttcagttcggccgcttctat
cgtctcgccggtttttgcgccgccggtggtgcgaccggcggcatgaccggcgggccggca
gggaccggacaggggtggccgggatcgaggcctgcaggaaactcaaatctggttgcctgg
atgtccgtgtccgaggatagccgacgggctgtggtcctcattgtccaggtccttgcccgg
cccaatcccggcttctaccgcatccccctacggggcctcgatcctgacctgagctatcag
gtccgctgccggcccgccctgccggttaaggatgaagcggcgattcggtacaatgaaggc
ctccggcagggagatgagctcatcaatgtggggcttctcttaggcggggacggctggaat
gggctttcccggggagattttgcatcctggctctttacgctcgaaggctga

DBGET integrated database retrieval system