KEGG   Spirochaeta caldaria DSM 7334: Spica_0439Help
Entry
Spica_0439        CDS       T01573                                 

Definition
carboxypeptidase Taq (EC:3.4.17.19)
Orthology
K01299  
carboxypeptidase Taq [EC:3.4.17.19]
Organism
scd  Spirochaeta caldaria DSM 7334
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
480244..481764
Genome map
AA seq 506 aa AA seqDB search
MEKQAALERLHALDRDIKHLRQVTAILQWDQETYMPPAAVEGRSEQLALLEGIIHEKSTS
PEIGNLLEQLGSTTIKPQGDTDLPDVERDFLRVVRKNYDRAVLLPAELVTESARAEGISQ
AAWVEARKHNDYKTFMPHLEKMIGYAKKKAECWGYTEHPYDGLLNIYEPGMTEGSIAGVF
GPLRTRLSQLVQRISAKNPPRSEFLAREFPKDLQAQFGESVMKDLAYDLSQGRLDISAHP
FTTTLGPRDVRITTRYFPTNVLSGLFSIIHETGHALYEMGFADNIRDSSLGDGASMGIHE
SQSRLWENVIGRSFAFWKGQYPLLKKLFSDQLTDISVEDFYTAVNRVQPSLIRVDADEVT
YSLHVILRFELERKLFSGNLSVMDLPEAWNDMMQEILGVKPDSDANGVLQDVHWSMGAFG
YFPSYAMGNLYGLQLWEALQADIPDVEACIEQKNYGPILHWLRAQVHIHGCRYEPKDLIV
KITGKPLSAEPFINYLEHKYEQLYNL
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaacaggcagcgctggagcggcttcacgctcttgatcgggacattaaacattta
agacaggtcactgctatccttcaatgggaccaggaaacctatatgccccctgctgcggtc
gagggccgttccgagcagctggcattgttagaaggaatcatacatgaaaaatctacatct
ccggaaattggcaatcttctcgaacaacttggttcaacgacgataaagcctcagggcgat
accgatttaccggatgttgaacgggattttcttcgggttgtaagaaaaaactatgatcgt
gctgtcctcctacctgctgaactggttaccgaatctgcccgggcagagggaatttcacaa
gccgcctgggtagaagctcgtaaacataacgattataaaacctttatgccccatctggaa
aaaatgatcggctatgcaaagaaaaaagccgaatgctggggctatacagagcatccctat
gatggtcttctgaatatctatgaaccgggaatgaccgaaggctccatagcgggtgtgttc
ggtcccctccggacacggctgtctcaattagttcagcgaattagtgccaagaatcccccc
cgtagtgaatttctcgcaagagaattccctaaagatcttcaggctcaattcggtgaatcg
gttatgaaagatctcgcctatgacctcagccaggggcggctcgatatcagtgcccatccc
tttactactaccttaggtccccgggatgttcgcatcaccacccgttatttccccacaaat
gtactttctggtcttttctcgattattcatgagacgggacatgctctgtatgaaatgggg
tttgccgataacatccgggattcctcacttggtgatggcgcttccatgggaattcacgaa
tctcagtcccgtctctgggagaatgtgataggccggagctttgccttctggaaaggtcaa
tacccccttctgaaaaaactgttttccgatcaattaacagatatctcggtagaggatttt
tatactgcggtaaaccgggtacagccgtcacttatcagggtagatgcagatgaggttacc
tacagtctgcatgtgatactacgcttcgaactcgaacgaaagcttttctcgggaaatctc
tcggtaatggacctgcccgaagcctggaatgacatgatgcaggaaatccttggggtaaag
cctgattcggatgccaatggggttttgcaggatgtccactggtctatgggtgcctttggc
tatttcccaagctatgccatgggaaatttatatggattgcagctctgggaggcgttacag
gcagatattcctgatgtcgaagcctgtatcgagcagaaaaattacggaccaatcctgcat
tggctcagggctcaggtacatatacatggctgccgttatgaaccaaaggatctcatcgta
aagattaccggaaaaccgctgtcagccgaaccgttcatcaattatttggagcacaagtac
gaacagctttataatctctag

DBGET integrated database retrieval system