KEGG   Treponema caldarium: Spica_0529Help
Entry
Spica_0529        CDS       T01573                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
scd  Treponema caldarium
Pathway
scd00521  Streptomycin biosynthesis
scd00523  Polyketide sugar unit biosynthesis
scd01130  Biosynthesis of antibiotics
Module
scd_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:scd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Spica_0529
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Spica_0529
Enzymes [BR:scd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Spica_0529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: AEJ18691
JGI: Spica_0529
UniProt: F8F038
Position
573594..574142
Genome map
AA seq 182 aa AA seqDB search
MPINVTPLPIEGLYIIEPRVFGDARGYFFESYNERDFNTAGLTMRFVQDNQSFSRMGVLR
GLHFQKQHPQGKLVRVIQGEVYDVAVDIRPGSKTYGQYHGLILSSEKQNQFYIPPGFAHG
FVVLSETAIFAYKCTDYYHPEDEGGIRWDDPDLSIPWPLKEVQVSPKDAQLPYLKDIKKE
NL
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcaatgtcacacccctccccatagaaggactttatatcattgagccccgggtg
tttggcgacgctcggggctattttttcgagtcctacaacgaacgggattttaacactgcg
ggccttaccatgcgctttgtccaggataaccaatccttttccaggatgggcgtactgcgg
ggcctccatttccagaaacagcacccccaggggaaactcgtccgggtaatacagggcgaa
gtctacgatgtcgccgttgatatccgacccggttcaaagacctatggccagtaccatggc
cttatactaagcagcgaaaagcagaaccagttttacattcccccaggttttgcccatggt
tttgtggtcctctccgaaaccgccatctttgcctataaatgcaccgactactaccacccg
gaagacgaaggaggcatccgctgggatgatcctgacctctccatcccctggccccttaag
gaggtgcaagtttctcctaaagatgcacaattgccctatttaaaagatattaaaaaggaa
aatctatga

DBGET integrated database retrieval system