KEGG   Treponema caldaria: Spica_0619Help
Entry
Spica_0619        CDS       T01573                                 

Definition
pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
scd  Treponema caldaria
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Spica_0619
   00500 Starch and sucrose metabolism
    Spica_0619
Enzymes [BR:scd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Spica_0619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
674516..676348
Genome map
AA seq 610 aa AA seqDB search
MADVDTSFFLYIPGKKSLDIVQDLAEHGFGHLDEIKKHVSFLYNVDKKPMAIQFDTTDGN
NDFITYPVPEQTKRVTILFKARGAKDADTGTPYGMFWAGWQRGEYQSLLRHNHSNQIKGP
IGQTNLKPDDIVSDWHDFRLVFEVASDNKAMTAKAYIDNKLRHITEQYVRQNTEWAGAGN
YIAFGDYDGSTNGFARYLYLLLIFDEDVSELSLSQLSQRVGFDLTNIPALVNDKDPPSKR
PAFKPNGITMFAHEVNKDAAWVDPATIHNDKIDLDCLPYSKNKALVIQKKPPSFDIKKTV
SSITVSSDGSPGTFKTIAEAIDVAQPGTIIFIRKGLYKEKLKITKPDITLIGENPANTII
YGYEADVGGIDGNILVEVSLQGESFNACNLTFYNKGAEWNKTWGKAERRSVAFAVRNVGK
GFVRNCIFLGQQDTLYLRSGRLYMENCYVEGEVDFICGGATVFFQNCQIHSIYYPQGGYI
TAAAPADSGGLGFDNGYVFNQCIFTADPALEQAKPVYLGRGAWQNGSNGKGPAKVVIQNS
IISKISGKTGWTDWDTESTAERQFFREYNNTGEGAIQGERPGRKVLTDQEYQTLYSTPEQ
VLGYTPQLPW
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atggcagatgttgatacttccttttttttatatatacctgggaaaaaatccttagatatc
gttcaagatttagctgaacatggttttggtcatttagatgaaataaaaaagcatgtatcg
tttctttataatgttgataaaaaaccaatggcaatacaatttgatacaaccgatggcaat
aatgattttattacctatcctgtaccagaacaaacgaaaagggtaacgattcttttcaaa
gcccgtggtgcaaaggatgcagatacaggaacaccttatgggatgttttgggcaggctgg
caacggggcgaataccaatccctactacggcataatcatagcaaccaaattaagggccct
ataggtcagaccaatctaaagcccgatgatattgtttcagactggcatgattttcgtctt
gtttttgaagtagcctcagataacaaagctatgactgcaaaagcatatattgataataaa
ctacggcatattacagaacaatatgtaagacaaaatacagaatgggctggtgcaggtaat
tatattgcctttggagattatgatggaagtaccaatggttttgctcgttatttatattta
ctcttaatttttgatgaggatgtatctgaattgtccttatctcaattgagccaacgggtt
ggatttgatttaacaaatatacctgctttagttaatgataaggatccaccaagcaaacga
ccggcttttaaaccaaacggtattaccatgtttgcccatgaggtgaataaagatgctgca
tgggtggatcctgcgacaatccacaatgataagattgaccttgattgtttgccgtacagt
aaaaataaagccttagttattcaaaaaaaaccaccatcttttgatataaaaaaaactgta
tcatctattaccgtatcatccgatggttcgccgggaacctttaaaactattgcagaagcc
atcgatgtagcacaacctggaactataattttcattcgaaagggtttgtacaaggaaaaa
ttaaaaattacgaaacctgatataacacttattggagaaaatccagctaataccattatc
tatggatatgaagcggatgtgggtggtattgatggaaatattttagtagaagtttcatta
caaggtgaatcctttaatgcctgtaatcttaccttttataataaaggtgctgaatggaat
aaaacctggggtaaagctgaacgacgatctgttgctttcgctgtccggaatgtaggaaaa
ggttttgtgagaaattgtatctttttaggacagcaggataccttgtatttacgctctgga
cgattatatatggaaaactgttatgtggaaggcgaggtagactttatttgtggtggtgct
acagtattttttcagaattgtcagatccattcaatttattatccacaagggggctatata
actgcagcagctccagctgattctggcggtttagggtttgataatggttatgtatttaat
caatgtatatttaccgctgatcctgcattggaacaagcaaaaccggtctatcttggtcgt
ggggcatggcaaaatggtagtaatggaaagggccctgcaaaggttgttatccagaattcg
ataatctcgaaaatatctggtaaaacagggtggaccgattgggatacagaaagcaccgca
gaacggcaattttttagagaatataacaatactggtgaaggggcaattcaaggagaaaga
cctggcagaaaagtattaacagatcaggaatatcagaccctttattctacaccagaacaa
gtattaggatatacacctcaattaccttggtaa

DBGET integrated database retrieval system