KEGG   Treponema caldaria: Spica_0723Help
Entry
Spica_0723        CDS       T01573                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
scd  Treponema caldaria
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:scd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Spica_0723
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Spica_0723
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Spica_0723
Enzymes [BR:scd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Spica_0723
Exosome [BR:scd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Spica_0723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
790543..792042
Genome map
AA seq 499 aa AA seqDB search
MKRRAFVPALLGSLFVLLVAGNLYAGGAKDAAATSSTVAQKQKAVKYVFFFVGDGLAMPQ
ISATEAYANALASKDVNVKRLGFSQFPVTGLCTTYDAGSLITDSASAGTAFASGNKTLNG
VINMDVSKTKTYKTIAEYAKERGKKVGVVSSVSIDHATPASMYAKVPSRNNYYDIAVQLT
ESGFDYFGGGSFLQPTGKNKDKPSVYDLAKAKGYTVADSVAAIQGLKAGAGKVIAINPNL
QDSSAMKYDIDREAGELALVDFVRKGIELLQDGPEGFFLFVEGGKIDWACHANDAASAIK
DTLAFDRAVAEAVAFAEKHPEETLILVTGDHETGGMAIGFAGTQYETFFDKIAPQKMSYV
AFNDKVLTPYKKATPKEKAKLEDLAPAIKDAFGIELASLNQLQKEQVERAFKRTMGNEVE
RSIKEEEYLLYGGYEPLTVKLTQILNQMAGIGWTSYSHTGVPVPVFAKGIYQDVFSSYYD
NTDLFKKLAMAMGVTERVQ
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtagagccttcgtccccgctctgttggggagcctgttcgtgctgttggttgca
ggaaacctgtatgcgggcggtgcaaaggatgcagctgctacaagcagtacggtagcacag
aaacagaaagcggttaagtatgtattcttctttgtgggtgatggtcttgcgatgcctcag
attagtgccaccgaggcgtatgccaatgcccttgcatccaaggatgtgaatgttaagcgg
cttgggttctcccagttccccgtaacagggctctgcactacctatgatgcgggttcgctc
atcaccgattcagcctctgcgggcactgcctttgcttcaggcaacaagaccctcaatggg
gtcatcaatatggatgtgtctaaaaccaagacctataaaaccatagctgagtatgctaag
gaacgtggaaaaaaggtcggggttgtttcatccgtatctatcgaccatgcgacccctgca
tccatgtatgctaaggtaccgtcccggaacaactactatgatatagcagtgcagcttacc
gaaagcggctttgattattttggcggcggcagttttctacagcccaccggcaaaaacaag
gataaacccagtgtgtacgatctggcaaaggcaaagggctatacggttgccgattcggtc
gcagcaattcagggactcaaagctggtgcaggaaaggttattgccatcaaccccaacctg
caggattcttccgctatgaaatatgacatcgatcgggaagcgggtgaacttgcactggtc
gactttgttcgtaagggaatagagcttctgcaggatggacctgagggcttcttccttttt
gtggagggtggcaagattgactgggcctgccatgccaacgatgcagcctctgcgataaag
gatacccttgccttcgatagggcggtggcagaagcggttgcctttgcggaaaagcaccca
gaagagactctcattctggttaccggtgaccatgaaacgggcggtatggccattggtttt
gccggtacccagtatgaaaccttctttgataaaattgcaccccagaagatgtcctatgta
gcttttaacgataaggtcctaacgccttacaagaaagcaacgcccaaggagaaggccaaa
cttgaggatcttgctcctgctattaaagacgcctttggtattgaactggcgagccttaat
cagctccagaaggaacaggtagaacgggcctttaagcgaaccatggggaatgaagtggaa
cgctctataaaggaagaagaatatcttctgtacggtggctacgaacccttaacagttaag
ctgacccagattctaaaccagatggctggtatcggctggaccagctattcccataccgga
gttccggtgcccgtatttgcgaagggaatatatcaggatgtgttctcttcctactacgat
aatacggacctctttaagaagctcgccatggctatgggagtgaccgagagagttcagtga

DBGET integrated database retrieval system