KEGG   Spirochaeta caldaria DSM 7334: Spica_0723Help
Entry
Spica_0723        CDS       T01573                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
scd  Spirochaeta caldaria DSM 7334
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:scd00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:scd00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:scd02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
790543..792042
Genome map
AA seq 499 aa AA seqDB search
MKRRAFVPALLGSLFVLLVAGNLYAGGAKDAAATSSTVAQKQKAVKYVFFFVGDGLAMPQ
ISATEAYANALASKDVNVKRLGFSQFPVTGLCTTYDAGSLITDSASAGTAFASGNKTLNG
VINMDVSKTKTYKTIAEYAKERGKKVGVVSSVSIDHATPASMYAKVPSRNNYYDIAVQLT
ESGFDYFGGGSFLQPTGKNKDKPSVYDLAKAKGYTVADSVAAIQGLKAGAGKVIAINPNL
QDSSAMKYDIDREAGELALVDFVRKGIELLQDGPEGFFLFVEGGKIDWACHANDAASAIK
DTLAFDRAVAEAVAFAEKHPEETLILVTGDHETGGMAIGFAGTQYETFFDKIAPQKMSYV
AFNDKVLTPYKKATPKEKAKLEDLAPAIKDAFGIELASLNQLQKEQVERAFKRTMGNEVE
RSIKEEEYLLYGGYEPLTVKLTQILNQMAGIGWTSYSHTGVPVPVFAKGIYQDVFSSYYD
NTDLFKKLAMAMGVTERVQ
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtagagccttcgtccccgctctgttggggagcctgttcgtgctgttggttgca
ggaaacctgtatgcgggcggtgcaaaggatgcagctgctacaagcagtacggtagcacag
aaacagaaagcggttaagtatgtattcttctttgtgggtgatggtcttgcgatgcctcag
attagtgccaccgaggcgtatgccaatgcccttgcatccaaggatgtgaatgttaagcgg
cttgggttctcccagttccccgtaacagggctctgcactacctatgatgcgggttcgctc
atcaccgattcagcctctgcgggcactgcctttgcttcaggcaacaagaccctcaatggg
gtcatcaatatggatgtgtctaaaaccaagacctataaaaccatagctgagtatgctaag
gaacgtggaaaaaaggtcggggttgtttcatccgtatctatcgaccatgcgacccctgca
tccatgtatgctaaggtaccgtcccggaacaactactatgatatagcagtgcagcttacc
gaaagcggctttgattattttggcggcggcagttttctacagcccaccggcaaaaacaag
gataaacccagtgtgtacgatctggcaaaggcaaagggctatacggttgccgattcggtc
gcagcaattcagggactcaaagctggtgcaggaaaggttattgccatcaaccccaacctg
caggattcttccgctatgaaatatgacatcgatcgggaagcgggtgaacttgcactggtc
gactttgttcgtaagggaatagagcttctgcaggatggacctgagggcttcttccttttt
gtggagggtggcaagattgactgggcctgccatgccaacgatgcagcctctgcgataaag
gatacccttgccttcgatagggcggtggcagaagcggttgcctttgcggaaaagcaccca
gaagagactctcattctggttaccggtgaccatgaaacgggcggtatggccattggtttt
gccggtacccagtatgaaaccttctttgataaaattgcaccccagaagatgtcctatgta
gcttttaacgataaggtcctaacgccttacaagaaagcaacgcccaaggagaaggccaaa
cttgaggatcttgctcctgctattaaagacgcctttggtattgaactggcgagccttaat
cagctccagaaggaacaggtagaacgggcctttaagcgaaccatggggaatgaagtggaa
cgctctataaaggaagaagaatatcttctgtacggtggctacgaacccttaacagttaag
ctgacccagattctaaaccagatggctggtatcggctggaccagctattcccataccgga
gttccggtgcccgtatttgcgaagggaatatatcaggatgtgttctcttcctactacgat
aatacggacctctttaagaagctcgccatggctatgggagtgaccgagagagttcagtga

DBGET integrated database retrieval system