KEGG   Spirochaeta caldaria DSM 7334: Spica_0752Help
Entry
Spica_0752        CDS       T01573                                 

Definition
acetylornithine deacetylase / succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
scd  Spirochaeta caldaria DSM 7334
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:scd01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:scd00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
829338..830564
Genome map
AA seq 408 aa AA seqDB search
MLEKIYSYIDGSTATLVELETELCKRPALSPDSGGVGELEKVEFLQSWLKAHGIQNLERH
DAPDSRAKGGIRPNLIATIPGKSDTKRLWIMSHTDVVPPGELSLWNNDPWQVVVKDGRLI
GRGVEDNQQGLTSSVLAALALVSQGITPPHTVKLLFVADEEMGSEYGIQWLLANRNLFRP
DDMVVIPDGGDERGETIEVAEKNLLWLKIKTSGKQCHGSRPDQGANAHLAACELAVRLHD
ELPLRFNAHDRLFDPDYSTFEPTKHEANVPNVNTIPGDDVFYMDMRVLPQYPLKDVLAEV
ERIMAEVSAKRGVQMSYEALQRVESKATRPDAPLVQFLSQAVKQVYGVETRPIGIGGGTV
GAYLRNVGIDSVVWGRLHESAHQPNEYALIENIIGDAKVMATLMMEQR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaaaaatatattcctatattgacggaagcaccgccacgttggtagagctggaa
accgaactttgtaagcgtccagccctgtcccccgattctggcggggtaggggagcttgaa
aaggtagagtttctccagtcctggcttaaggcccatggcatacagaatctagagcggcat
gatgcgccggatagccgggccaagggcggtattcgccctaatctgattgctaccatcccc
ggaaaatccgacaccaagcggctttggattatgagccataccgacgtggttcccccgggg
gagctgtcactctggaataatgatccctggcaggtggtggttaaggatggccgcctcatt
ggccgcggtgtggaagataaccagcagggccttacctcatcggtactggccgcccttgcc
ctggtcagtcaggggattacaccgccccatacggtaaagctcctctttgtggccgatgag
gaaatgggcagtgaatacggcatccagtggcttttggccaaccgcaacctgttcaggcct
gatgatatggtggtaattcccgacggaggcgatgaaaggggcgaaaccatcgaagtagcc
gagaagaacctcctctggcttaagataaaaacctcaggcaagcagtgccatggctcccgg
cctgatcagggagctaatgcccatctggcggcctgcgaactggcggtccgtctccatgac
gaattgccgctccgctttaatgcccatgacaggctgtttgatcccgattattccaccttt
gaaccgaccaagcatgaagccaatgtgcccaatgtaaacaccatccccggcgatgatgtg
ttctacatggatatgcgggttcttccccagtatccccttaaggatgttctggccgaagtg
gagcggattatggcagaggtttctgcaaaacggggggttcagatgagctatgaagcactc
cagcgggtagaatccaaggctaccaggcccgatgctcccctggtacagttcctgtcccag
gcggttaaacaggtctatggggtggaaacaagacccatcggtatcggcggcggcaccgtt
ggagcctatttacggaatgtgggtatcgattctgtcgtatggggccggctccacgagagt
gcccatcaacctaatgaatatgcactcatagaaaatatcatcggcgatgccaaggttatg
gccacccttatgatggaacagcgataa

DBGET integrated database retrieval system