KEGG   Treponema caldaria: Spica_0790Help
Entry
Spica_0790        CDS       T01573                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
scd  Treponema caldaria
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Spica_0790
Enzymes [BR:scd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Spica_0790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
869344..870267
Genome map
AA seq 307 aa AA seqDB search
MGDGIRVAAPCKINLHLGIFDRRSDGYHPIESIFQMLDFGDTIWIESLKKSSGIELHMEG
SVPMKDVVPPEQNSIYTAVRLFQMESGCESGWYIRLNKHIPLGAGLGGGSADAAAVLLAL
NQICGKPFSDISLEHFAAKLGSDVPFFIKGGTAYVTGRGERISPISVTTSWAVLLVNPGI
HSSTPEAFRLLDTVRSETRVCTKPLLGRDVLVRLLESHPQHWTFYNDFLEVFLKHGTLEV
QQTYQAILRELREAGADFVNLSGSGSTCFGVFADHDKARKTLQNMKGRWPLVELTFPLAR
KVNPVVE
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgggagatggtatacgagttgcggcaccttgcaaaatcaacctccatctcggaatattt
gatcgaagatccgatgggtatcatccgatcgaaagtatttttcaaatgctcgattttggt
gacactatctggattgaatctttgaaaaaaagctctggtattgaacttcatatggaaggt
tcggttccaatgaaggatgtggtgccgcctgagcaaaatagtatatatacagcagttcgt
ctgttccaaatggaatctggctgtgaaagtggatggtatatccgtctcaataaacatatt
cctcttggtgcggggttggggggcgggtcggccgatgccgctgcagtgttactagcactt
aatcaaatttgtggtaaaccattttcagatatcagtttggaacattttgctgctaagctt
ggaagtgacgttcccttttttataaaaggtgggactgcatatgtaaccggacggggtgag
cgtatttcacctatttcggtgaccacttcttgggctgtattactagtaaatcccggaatt
catagtagtactccagaggcttttcgtttattggatacagtgcgaagtgaaaccagagta
tgtactaaacctctgttgggtagggatgtattagtaaggttgctggaaagccatccgcag
cattggactttttacaatgattttttagaggtgtttctaaaacacggtacattggaggtt
caacaaacctatcaggcgattttacgggaacttagggaagcaggggcggattttgtcaat
ctttctggctctggttcaacctgttttggtgtttttgctgatcacgataaggccagaaag
acgcttcaaaacatgaaaggtcgatggcctttagtagaattaacctttcctcttgcgcgt
aaggtgaatccagtagtagaatag

DBGET integrated database retrieval system