KEGG   Treponema caldaria: Spica_0819Help
Entry
Spica_0819        CDS       T01573                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
scd  Treponema caldaria
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:scd00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Spica_0819
Enzymes [BR:scd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Spica_0819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
901995..902867
Genome map
AA seq 290 aa AA seqDB search
MRMLNFGSLNIDYVYRVDTFLKPGETKAAKSRAVFAGGKGLNQSLAMAKAGLPVYHAGKV
GAEGDYLVDTLQKGGVNTSLIGRSDEPSGHTIIQVDDQGRNCILLFGGANQDIDETYIDE
VLASFGQGDYLVLQNEISLVPLIIEKAKAQGLFIILNPSPYTKEILTYPLEFIDMFLLNE
IEAEGFTGQTDPRKALDALCTRFPHAHMVLTLGEKGALWGRGTEVLFQKAYPVKAVDTTA
AGDTFSGYFIAGLVEGLAVSQSLDLAARAASLCVSRPGAADSIPWRRELG
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatgcttaactttggttcactaaatatagactatgtataccgggttgataccttt
ttaaagcctggtgaaaccaaggcggcgaaatcccgtgctgtttttgcagggggcaaaggt
ttgaaccaatccctcgccatggcaaaggcgggtcttccggtctatcatgcgggtaaagtt
ggtgcagagggggactacctggttgatacgctacaaaagggtggggtaaatacgagcctt
atcggtcgttccgatgagccttcggggcataccataatacaggtggacgaccaggggcgg
aactgcatccttctttttggtggagcaaaccaggatatagatgaaacctatattgatgag
gtccttgcttcttttggccagggggattacctggtattgcaaaacgagatttccctggta
cctcttattattgaaaaggcaaaagctcaaggacttttcatcatcctcaatccctcacca
tatacaaaagaaattcttacctatcccctggaattcatcgatatgttcctgttaaacgaa
attgaagccgagggttttacggggcagacggaccctcgcaaagctctggatgcactctgt
acccgattcccccatgctcacatggtactcacccttggcgagaagggcgctctttgggga
cggggtaccgaagtcctgttccaaaaagcctacccggttaaggctgtggacaccaccgcc
gcaggggataccttttccggctattttattgccggtcttgtggaaggccttgctgtgtcc
cagtccctggacctggctgcccgggcggcttcgctttgtgtcagcaggcccggtgctgca
gattccatcccatggcggcgggagctgggataa

DBGET integrated database retrieval system