KEGG   Treponema caldarium: Spica_0841Help
Entry
Spica_0841        CDS       T01573                                 

Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
scd  Treponema caldarium
Pathway
scd00330  Arginine and proline metabolism
scd00332  Carbapenem biosynthesis
scd01100  Metabolic pathways
scd01130  Biosynthesis of antibiotics
scd01230  Biosynthesis of amino acids
Module
scd_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:scd00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Spica_0841
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Spica_0841
Enzymes [BR:scd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Spica_0841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase HrpB2 GST_C_4
Motif
Other DBs
NCBI-ProteinID: AEJ18995
JGI: Spica_0841
UniProt: F8F0D1
Position
926834..927637
Genome map
AA seq 267 aa AA seqDB search
MIPQLIDQSRKIVIKVGSNTLADKQGHINRAFLSEFAEQVAGLLQKGKQIVLVSSGARIA
GISTIGKWERKRDIHYKQALCAVGQVELMEAWRKAFEPHQIHIGQLLLTADDFSNDIRTL
HMRNTLFTLVDEGVVPIINENDSVCVDEIKIGDNDNLAALSAILWSADLLILFSDIDGVY
TKNPKEHQDAELIEMVQDLSALKASISVGSTNSFGTGGIATKLEAAEKVLSYGIPMILAH
GGKNRVLESLQRGEQRGTAFIPAGGKP
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgattcctcaattaatagatcaatcccggaagattgttataaaagtcggttccaataca
ctggcagacaaacagggacacatcaaccgggcctttctttcggagttcgctgaacaggtt
gcaggccttctgcagaagggcaagcaaattgtcctcgtttcttccggagcccgaattgca
ggtatttccaccatcggtaaatgggaacgaaaacgggacatccactacaaacaggccctc
tgtgctgtcggccaggtcgaacttatggaagcctggcgcaaagcctttgaaccacaccag
attcatatcggccaactgctcctcaccgccgatgatttttccaacgatattcgtaccctc
cacatgcgcaataccctctttaccctggttgatgaaggggtagtacccattattaatgaa
aacgattcggtttgtgttgatgaaattaaaatcggcgataacgacaatctggccgctttg
tcggccatactttggagtgccgatctcctgatactctttagcgatatcgatggggtttat
accaagaatcccaaggaacatcaggatgcggaacttatcgagatggttcaggatctttcg
gccttgaaggcttccatctcagtgggcagtaccaacagcttcggaaccggcggtattgca
accaagctggaagcggctgaaaaggtgctttcctatggtataccgatgattcttgcccat
ggcggcaaaaaccgggtactcgaatccctacaaaggggggaacagcgggggaccgccttt
attccagcgggaggtaaaccgtga

DBGET integrated database retrieval system