KEGG   Spirochaeta caldaria DSM 7334: Spica_0844Help
Entry
Spica_0844        CDS       T01573                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
scd  Spirochaeta caldaria DSM 7334
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:scd00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:scd00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(929434..931128)
Genome map
AA seq 564 aa AA seqDB search
MILRAYKKVFIAILLVLFSLQSYRGFGAEHFYSPGKPEELAEKLLAAMSDEEALAQTFML
GWVGADPSPAIIDWIQKRHIGGIKIFGWNTEDTYRLANTVGVLQKAAQQSDKKIPLLVAT
DQEGGWIRHVKGITSETPGNMAIGASGVPRDAYLSGYYIGRELAALGINMNFAPSVDLFT
NQQSVLIGPRAFSDNPVTAGILGIAFAKGLEKAGVIPTAKHYPGHGDTELDSHGILPHIQ
ANFETLWNRELLPYRMLSKEGIPAIMTGHLAFPNTRGGSEPASLSRWFITTILRETIGFK
GLVITDDLLMNGVTIPAGSLSRAAKLALEAGNDILMMSKTPNLSDPVWNNLLDAMKREPK
FRERVRDAARRTLILKLTHLKGDTAPPLFPQADEIKKRIPDPQGKAFFLDLAARSITLVS
GTDPSPLEPSKAGKVLLAASFEDFLSVGLLAYPNAQRFKFSYSEESSPQDKLNFQSQAKQ
ADTIIFCLANGYGVDLLQSIRYSGKRVIVISALSPVYLQRVTWNTSGIAVYSYSRESFIA
VFSALLGRIPMQGKLPFAMKNLGR
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
gtgatattgagagcatataaaaaagttttcattgcaatcctgctagtactattctcactg
caaagctatcggggcttcggggctgaacatttttacagccccggaaaacccgaagaactg
gcagaaaaactcctcgccgccatgtccgatgaggaagccctggctcagaccttcatgctg
ggctgggtaggcgctgatccttcaccggctatcatagactggattcagaaacggcatata
ggcggcataaaaatctttggatggaataccgaagacacctaccggctggccaacaccgtt
ggagttttacaaaaagcggcacaacaaagtgataaaaagatccctctcctcgttgccacc
gatcaggagggtggctggatccgccatgtaaagggcattaccagcgaaaccccgggaaat
atggccatcggtgcctctggggttccccgggatgcctatctttccgggtattatattggc
cgggaactggcggcgctgggcatcaatatgaattttgccccttcggtggatctgtttacg
aaccagcagtcggttctgattggtcctcgggcttttagcgataaccctgtaaccgcagga
attttaggcatcgcctttgcaaagggtctggaaaaggccggggtaattcctacagccaaa
cattatcccggacacggagacacggaattggattcccatgggattcttccccacatccag
gccaattttgagaccctgtggaaccgggaattgcttccttaccgtatgctcagcaaggaa
gggatccctgccattatgacgggccacctcgcatttcccaacaccaggggagggagcgaa
ccagcgtcgctgagtcgctggtttatcaccaccattctgagagaaaccatagggtttaag
gggcttgttatcaccgatgatttattgatgaatggtgtcaccataccggcaggaagcctc
tcacgggctgctaaactggccctagaagcaggaaacgatatcctgatgatgtctaaaacc
ccgaacctttccgacccggtttggaacaatctgcttgatgccatgaaacgggaacctaag
ttccgggaacgggtcagagatgcagcccgcaggaccctgatcctaaagctcacccatctc
aaaggggacactgccccacccctgtttccacaggctgatgaaattaaaaaacgtatccct
gatcctcagggcaaggctttttttcttgacctggcagcaagaagcataaccctggtatcg
ggtaccgatccaagccccctcgaaccaagcaaggcaggcaaggtgctattggcggcctcc
tttgaggatttcctgtccgtgggtctcctggcctatcccaatgcacagcgatttaaattt
tcctattcagaagaaagctctccccaggataagctcaatttccagtcccaggcaaaacag
gcagatacgatcattttttgtcttgccaacggatatggggtcgaccttttacagagcatc
cgctattcagggaaacgagttattgtgatttcagccctgtctccggtgtatcttcagcgg
gtaacctggaataccagcggtattgcggtgtatagctattcccgggagtcctttatcgca
gtcttttctgccctcctgggccgcattcccatgcagggcaaattgccctttgctatgaaa
aacctggggagataa

DBGET integrated database retrieval system