KEGG   Treponema caldaria: Spica_0914Help
Entry
Spica_0914        CDS       T01573                                 

Definition
acylglycerol lipase (EC:3.1.1.23)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
scd  Treponema caldaria
Brite
Enzymes [BR:scd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Spica_0914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1004458..1005255)
Genome map
AA seq 265 aa AA seqDB search
METIKHTAIISGAEPFYFSGEKDAPGVLLIHGFTGTPKEMRWMGEYLHQNEGFSCIGPRL
AGHATSLDDMMRSTHHDWMVSVEEAYYMLRDRTNTVYIAGLSMGAALALLFGSILPVKGI
IAMASPYALPNDWRLKYTRLLSKIQPLMPKEHADPESGWFDKDAARDHLCYSHNPLRSIG
ELNLLLGRLREALPHIAVPTLLIYSKDDQALPLGSEYCMNEIFASIGTEQKEKILLSGSG
HVLTRDAKRLEVFQTAAEFIKRNEG
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccattaaacatactgccataatctcaggggcggagcccttttatttttcaggc
gagaaggatgccccgggggtccttcttattcatggctttaccgggacgcctaaagagatg
cggtggatgggtgaatatctgcaccagaacgagggcttttcctgcatcggcccccggctt
gctggtcacgctaccagcctcgatgacatgatgcgatccacccatcatgactggatggta
tcggtagaagaagcctactacatgctgagagatcggaccaatactgtttatatagctgga
ctttccatgggtgcggccctggctttactctttggcagtatcctccctgtgaagggtatt
attgctatggcttctccctatgccctccccaatgattggcggcttaaatacaccaggctc
ctcagcaagattcagcctcttatgcctaaggaacacgcggaccctgaaagtggctggttc
gataaggatgctgcccgggatcacctttgttatagccataaccccctgcgttctattggg
gaacttaaccttctcttaggaaggcttcgagaagcgcttcctcatattgcagtacctacc
ctgcttatctattcaaaggatgatcaggccctgccgctgggcagtgaatattgtatgaac
gaaatttttgcatccataggaactgaacaaaaggagaaaattctcctttccggctccggc
catgttcttacccgggatgcaaagcggctcgaagtattccagaccgcggcagagtttata
aagaggaatgaaggctaa

DBGET integrated database retrieval system