KEGG   Treponema caldaria: Spica_0984Help
Entry
Spica_0984        CDS       T01573                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
scd  Treponema caldaria
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:scd00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Spica_0984
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Spica_0984
Enzymes [BR:scd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Spica_0984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1082295..1083965)
Genome map
AA seq 556 aa AA seqDB search
MDRRFSEFFNPGLVKRVNCQVLRYKGQVFKLSPEADTLPPFTEAIQSAMDACILTDVTYD
SRQVQPGNIYFALPGLHTDGHQYIPQAIERGAAVIVHQYELDHYEPEVIYLQCSDSRFAM
SPISAIFFNEPSKELGIIGVTGTEGKSTTVFLIYQLLTLTGKKAGFISTVQYRIGDKEEW
NPEHQTTPEAPTIHRALAAMRDYGMEYAVIESSSHGLSPRTNRLGDVAFDVGVMTNVTHE
HLEFHGTWDQYRSDKANLFRVLDKVNHEKALRNGPLNEMGLRLPVRIPSFSVANADDPSC
TYFANATERRTYTYSIHGEDADLSIRNLEGTDRGNSYDIWVRATGEILHVQDNLPGTFNA
ANVMASLLVVSGLVGLPVTDLVPLVPRLRPVRGRMTVINRGQPFEVIVDYAHTPSSFETV
LPPIKKRIEGRGGRLISLFGSGGERDREKRPRQGKIAADWSDIVILADEDPRGEDPMELL
EEIAAGCSELVRGEQLYLIPDRPQAIRKAFSLAQPGDVVLLLGKGHENSIIYKDHTIPYD
EIGEAEKALAEMGFTN
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggatcgacgattttcagagtttttcaacccagggttggtaaaacgggttaactgtcag
gttttgcggtacaagggccaggtttttaagctttctccagaggctgatacactgcccccc
tttacagaagccatccaatccgccatggatgcatgcatactcaccgatgtcacctatgac
tcccgacaggtacaaccagggaacatatattttgccctcccggggctccataccgatggt
caccagtatataccccaggccattgagcgaggcgctgcggttatcgttcatcaatatgaa
ttggaccactacgaacctgaggtcatctacctgcaatgttccgactcccgctttgcaatg
tcacccatatcggctattttttttaacgaaccttcaaaagaacttggtatcatcggagta
accggtacggagggcaagagtaccacagtttttttaatctatcagctcttaaccctgacg
ggtaaaaaagcgggctttatttcgactgtacaataccgtattggcgataaggaagagtgg
aatcctgaacatcagaccactccggaagcgcccaccattcaccgggctctggcggccatg
cgggactacggtatggaatatgcggtcattgagtccagctcccacggcctttcaccccgg
acaaaccgtttgggggatgtggcctttgatgtgggggtcatgaccaatgtaacccatgaa
cacctggaatttcatggtacctgggatcagtaccgcagtgacaaggccaacctcttccgg
gttctggacaaggtaaatcatgaaaaagccctgagaaatgggcccttaaacgagatggga
cttcggcttccggtccgtattccatccttctcggtagccaacgcagacgacccaagttgc
acctattttgccaatgcgaccgaacggcgaacttatacctacagcattcacggagaagat
gcggacttgtccatccgaaacttggaaggtaccgatcgggggaacagctatgatatctgg
gtcagggcaaccggtgaaatcctccatgtacaggataatctgccgggaacctttaatgcg
gctaatgttatggcctcattactggtggtttcaggcctggtaggacttcctgtaacagac
ctggtgcctttagtaccccgcctgagaccggtacggggtagaatgacggtcatcaaccgg
ggtcagcccttcgaggtcatcgtggattatgcccatacgccctcttcctttgaaacggta
cttccacctataaaaaaacggatcgagggtcggggcggccgtctcatcagcctctttggt
tccggcggtgaacgggaccgggaaaaacggccccggcagggtaaaattgccgcagactgg
tccgacattgtcattttggccgacgaggacccccgtggggaagatcccatggagcttctg
gaagaaattgccgcaggctgttctgaacttgtacggggagaacagctctacctcataccg
gaccggccccaggcgattcgcaaagccttcagtctcgcccaaccgggcgatgtggtcctg
cttctgggaaagggtcacgaaaattctatcatttataaggatcatacaatcccctatgat
gaaattggggaagcagaaaaggctctggcagaaatgggcttcacaaactga

DBGET integrated database retrieval system