KEGG   Spirochaeta caldaria DSM 7334: Spica_1200Help
Entry
Spica_1200        CDS       T01573                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
scd  Spirochaeta caldaria DSM 7334
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:scd00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1351547..1352392
Genome map
AA seq 281 aa AA seqDB search
MTTQISLPNGQVLNLAGPPLVMAIVNCTEDSFYAPSRAQAQQAVDRALEAVAEGADIIDF
GAESTRPGAEYVDEEEELKRVVPVVQAFCRQSSVPVSVDTRKANVARAALDAGAQIINDI
SALYDDPNMAPLCAQAKVPVVLMHKKGIPATMQHQPYYDDVVREVNEFLIKAAKNAEQAG
IEHDSIILDPGIGFGKRLEDNLDLLAHLADIGNRDYPILIGLSRKSFLGAITGRGPEERL
AGTLAAHAAVFYQGAKIFRVHDVKETVDLIKVLNAIEQRKG
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgacaacacagatatcccttcccaatggtcaagtattaaatcttgctggtccaccgctg
gtgatggccattgttaattgtacagaagattctttttatgcaccaagccgtgcccaggct
cagcaagcggtggatcgagctctggaggctgtagccgaaggtgctgatataattgatttt
ggtgcagaatccacaagacccggtgctgaatatgtcgatgaagaggaggaactaaaacgc
gtagtaccagtagttcaagccttttgccgacaatcttccgtaccagtctcagtagatacc
cggaaggccaatgtcgcccgggccgctcttgatgcgggtgctcagataataaatgatatt
tctgctctgtatgatgaccctaacatggccccactctgtgcacaagctaaagttcccgtg
gttcttatgcataaaaagggcatccctgctaccatgcagcatcaaccctattatgatgac
gtggttagggaagttaatgaatttcttataaaagctgcaaagaatgcagaacaggctgga
attgaacatgattccattattctcgatcctggtatagggttcggtaagcgacttgaagac
aatttagatttgctagcccatcttgcggatattggaaatagggattatcctatattgatt
ggtctatcaagaaaatcctttttgggcgccataacaggaagaggtccagaagaacgatta
gcaggtacccttgcagcccatgcagcagtattctaccaaggtgcaaaaattttcagggtt
catgatgttaaagagacagttgatcttatcaaagtattgaatgctattgaacagcgaaaa
ggataa

DBGET integrated database retrieval system