KEGG   Treponema caldaria: Spica_1341Help
Entry
Spica_1341        CDS       T01573                                 

Definition
Holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
scd  Treponema caldaria
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:scd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Spica_1341
Enzymes [BR:scd01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Spica_1341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1515468..1516166
Genome map
AA seq 232 aa AA seqDB search
MFNSLRGMITEKRLDSLCIATGGIEWEVSVPLLDMEQLPPVGEEGRVLVWLYHREDQMRL
FGFVTEERRNTFLELIKVEGIGPRQAVKILSGISQDDLETALENEDIARLEAVPGLGKKT
AQKMILALKGKLAHPVSAAVAGSAYEELVNALADMGYDRKTAAEAVERAARLVNAEAVDR
AALHGASAASAARAVSTEALAGLSAASGTATLSQAEREKRIFKQAIVILSSQ
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgtttaacagtcttcgcggcatgattaccgaaaaacggctggattccctctgtattgcc
actggcggcattgagtgggaagtctcggtgccccttttggatatggaacagcttcctccg
gttggggaggaagggcgggtcctggtgtggctctaccaccgggaggaccagatgcggctc
tttggttttgtcacagaagaacggcggaatacctttttagagcttattaaagtggaaggt
atcggtccccggcaggcagtgaaaattttaagcggtatcagccaggatgacctggaaaca
gccctggaaaacgaggatattgcccggctcgaggcagtgcccggcctcggtaaaaagact
gcccagaagatgatcctggctctgaagggcaaactggcccatccagtgtctgccgccgtt
gctggttcggcctatgaagaactggttaatgccctggccgatatgggctacgaccggaaa
accgccgctgaggctgtcgaacgggcggcccggcttgtcaacgctgaggccgtcgatcgg
gcggccctgcatggggcttccgcggcttccgcggcccgggccgtcagtaccgaggctctc
gccggtctgtctgcggcttcaggaactgccaccctctctcaggcagagcgggaaaagcgg
atctttaagcaggcaatcgtcattttaagcagtcagtaa

DBGET integrated database retrieval system