KEGG   Treponema caldarium: Spica_1507Help
Entry
Spica_1507        CDS       T01573                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
scd  Treponema caldarium
Pathway
scd00010  Glycolysis / Gluconeogenesis
scd00052  Galactose metabolism
scd01100  Metabolic pathways
scd01110  Biosynthesis of secondary metabolites
scd01120  Microbial metabolism in diverse environments
scd01130  Biosynthesis of antibiotics
Module
scd_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:scd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spica_1507
   00052 Galactose metabolism
    Spica_1507
Enzymes [BR:scd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Spica_1507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEJ19651
JGI: Spica_1507
UniProt: F8EZ59
Position
complement(1704255..1705286)
Genome map
AA seq 343 aa AA seqDB search
MKIDKKTFGVLSHGETVDLYTLRAGEIQLSLSTYGATWVSLYVPSKRGQKDDVLLGYSTL
TEYTHNPSFFGVTVGRCANRISKGRFSLNGSTYALYKNDGENTLHGGRRGFDKRVWKAEA
YEEKGAVAVRFELESPDGEEGFPGTVKAVVTYTLNNNNEIHCEYKAKADMPTPINLTNHA
YFNLKGEGWGDILSHELTLFSSHIVESDTQLIPTGNLVPVQDTPFNFLQRKPIGRDIAQV
PGGYDHCYVVDGKLGKLRPCAEVYEGLTGRLMKVFTTQPGVQFYSGNFLNGEAGKSGSRY
IKHAGFCLETQHYPDSPNRPEFPSCIFGPDRKYHEEAVFSFEW
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgataaaaaaaccttcggagtactatctcatggtgaaacggtagatttgtat
actcttagggcgggagaaattcagttatccctctccacttacggtgcgacctgggtgtcc
ctctatgtaccatcaaaaagaggacaaaaagatgatgttctattaggatattcaacttta
actgaatatacccataatcccagtttttttggtgtaactgtgggtcgttgtgcaaatcgt
atttcaaaggggagattcagcctcaatggttctacctatgctttatataaaaatgatggc
gaaaacacccttcatggtggtcgtcggggctttgataaacgggtctggaaggctgaagcc
tatgaggaaaagggggctgttgcagtccgctttgaactggagagtcccgatggtgaggaa
ggcttccccggtacagtaaaagctgtggtcacctacaccctgaataacaacaatgaaatc
cattgtgaatacaaggcgaaagctgatatgcctactcccatcaatcttaccaatcatgct
tattttaaccttaagggagaaggttggggagatattctttcccatgagctgacccttttc
tcatctcatatcgtggaatccgatacacagctcataccaacaggaaatcttgtgccggta
caggacactccctttaatttcttgcagcgcaaacctattggccgtgatattgcccaggtt
cctggaggatatgatcattgttatgtggttgatggaaagctgggcaaactacgtccctgt
gcggaagtatatgaaggccttaccggacggcttatgaaggtctttactacccagccaggg
gtacaattttattcagggaattttctcaatggtgaggctggaaaatctggctcacgctac
ataaaacatgccggtttttgcctggaaacacagcattatcccgacagccccaatcgtcct
gaattcccatcctgtatttttggtccagaccgtaaatatcatgaagaagcagtctttagt
tttgaatggtaa

DBGET integrated database retrieval system