KEGG   Treponema caldarium: Spica_1708Help
Entry
Spica_1708        CDS       T01573                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
scd  Treponema caldarium
Pathway
scd00010  Glycolysis / Gluconeogenesis
scd00020  Citrate cycle (TCA cycle)
scd00620  Pyruvate metabolism
scd01100  Metabolic pathways
scd01110  Biosynthesis of secondary metabolites
scd01120  Microbial metabolism in diverse environments
scd01130  Biosynthesis of antibiotics
scd01200  Carbon metabolism
Module
scd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:scd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spica_1708
   00020 Citrate cycle (TCA cycle)
    Spica_1708
   00620 Pyruvate metabolism
    Spica_1708
Enzymes [BR:scd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Spica_1708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 VRP3 ATP-synt_ab_Xtn QRPTase_N FAP
Motif
Other DBs
NCBI-ProteinID: AEJ19851
JGI: Spica_1708
UniProt: F8F204
Position
complement(1906294..1907634)
Genome map
AA seq 446 aa AA seqDB search
MAVPVPMLALSPTMTEGTIATWKIKEGDEVKRGAVLCEVETDKAVMDYEAGSQGTLLKIV
APAGSSVKVGDLIAVIGTQGEDISAILNQAASQSTAPAADGNPASPLPGPQVPKAPQAAQ
PQAAQPQAAKPQAAQPQAAAPFLPGGVAPSSPLARKLAQQAGIDLRSLTGSGPGGRIVKR
DIIRYLESPASRSDALFGADSHTQNRASYGAQTAEARTLPVSRLRQTIARRLGESMRDAP
HFYLRMAIDMEHLINLRTSYNQARKDGFTISLNAIFMKLTAMALAKHPQVNSSWLGDRIQ
IHAQVDMALAVALEDGLVAPVVRDCAHKGIEEIERELRDLIARAKEGSLKPEDYEGATFT
ISNLGAWGVEEFTAIINPPGSAILALGAIKKEVVVHTDSQGQDSMVIRPMMRATLSSDHR
TIDGAVAAAFMKDLAAIWEDPAKALF
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggcagtacctgttcctatgttagccctttcacctaccatgaccgaaggaaccattgcg
acctggaagattaaagaaggggatgaagtgaaacgcggagcggtgctctgcgaagtcgaa
accgataaggcggttatggactatgaagctggttcccagggtacgctgcttaaaattgta
gcccccgcagggagttctgtaaaagttggggatctcattgcggtgattggaactcagggc
gaggatatttcagctatcctgaaccaggccgcttcgcagagcaccgctccggcagcagat
ggaaatcccgcatcaccgcttccggggccgcaagtgccaaaagcgcctcaggcagcacaa
cctcaggcagcacaacctcaggcagcaaaacctcaggcagcacaacctcaggcagccgcc
ccattcctgccaggcggagtagccccatcatcccccttagcacgaaaacttgcccaacag
gcaggcattgatttgcggtccctgactggatctggtcccggtggccgtattgtaaagcgg
gatattattcgatatttagaaagtcctgcttcccgatctgatgctttgtttggagccgac
tctcatactcaaaatcgtgcatcctatggagcgcaaactgcggaagctagaaccttaccc
gtttcccggctcaggcaaaccattgcccgcaggctgggggaatctatgcgggatgcgccc
catttttacttgcgtatggccatcgatatggagcatctcatcaatctgaggacttcctat
aaccaggcgcgcaaggatggttttacgatctcattgaacgcgatcttcatgaaactcact
gccatggcacttgctaaacatcctcaggttaacagcagctggctgggggatcggatccag
atccatgcacaggtcgatatggctcttgcggtagcgctggaagatggccttgttgctccg
gtggttcgggattgtgcccataagggtatcgaagaaatagaacgggaattgcgggatctc
attgcccgagctaaggaaggcagccttaaacctgaagattatgaaggggctaccttcacc
atttccaatctgggtgcttggggtgtagaggaatttactgctattatcaatccccccggt
tcggcgatactcgccttaggggctattaaaaaggaagtggtggtacataccgattcccag
gggcaggacagtatggtaattcgacccatgatgcgggcaaccctctcaagtgatcatagg
actatagatggggctgtcgcagcagcctttatgaaagatctcgctgcaatctgggaagat
ccggcaaaagccttgttttaa

DBGET integrated database retrieval system