KEGG   Spirochaeta caldaria DSM 7334: Spica_1782Help
Entry
Spica_1782        CDS       T01573                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
scd  Spirochaeta caldaria DSM 7334
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:scd01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:scd01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:scd00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:scd00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:scd00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1962921..1963532
Genome map
AA seq 203 aa AA seqDB search
MYSFIFIRHGHSQADVENAFEGRLDMPLTDLGKNQAKTASEKLIKMNYKFDKIICSPLKR
AKETANIINEKYHLEIIENDLLIEQDNGILTGQNKKLMEIKYPIPKFINPFRKFPENTGE
SDFELHARAGFALNSLMDNKPGTYLIVSHGRILNALIRNILQIPIPINNTGVYFGFGDIG
LIDLIYKEDEHKWFLMKFEESLS
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtattcatttattttcattagacatggtcattctcaagctgatgttgaaaatgcattt
gagggtcgtcttgatatgcctttaactgacctaggcaaaaatcaagctaaaactgcttct
gaaaaattaattaaaatgaactataaatttgataaaataatttgctctccattaaaacga
gcaaaggaaaccgcaaacataataaatgaaaaatatcatttggaaattattgaaaatgat
ttgttaattgaacaagacaatggaatattgacaggtcaaaataagaaattaatggaaatt
aaatatccaataccaaaatttataaatccatttagaaaatttcctgaaaacactggcgaa
agcgattttgaattacatgcaagagcaggatttgcattaaattctttaatggataataaa
cctggaacatatttaattgtttcgcatggtagaattttaaatgcattaattagaaatata
ttacaaattccaataccgataaataatacaggagtatattttggatttggagatattgga
ttaattgatttaatttataaagaagatgaacataaatggtttttaatgaagtttgaggaa
agtttgtcctaa

DBGET integrated database retrieval system