KEGG   Treponema caldaria: Spica_1782Help
Entry
Spica_1782        CDS       T01573                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
scd  Treponema caldaria
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:scd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Spica_1782
   01230 Biosynthesis of amino acids
    Spica_1782
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spica_1782
  Energy metabolism
   00680 Methane metabolism
    Spica_1782
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spica_1782
Enzymes [BR:scd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Spica_1782
Exosome [BR:scd04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Spica_1782
  Exosomal proteins of melanoma cells
   Spica_1782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1962921..1963532
Genome map
AA seq 203 aa AA seqDB search
MYSFIFIRHGHSQADVENAFEGRLDMPLTDLGKNQAKTASEKLIKMNYKFDKIICSPLKR
AKETANIINEKYHLEIIENDLLIEQDNGILTGQNKKLMEIKYPIPKFINPFRKFPENTGE
SDFELHARAGFALNSLMDNKPGTYLIVSHGRILNALIRNILQIPIPINNTGVYFGFGDIG
LIDLIYKEDEHKWFLMKFEESLS
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtattcatttattttcattagacatggtcattctcaagctgatgttgaaaatgcattt
gagggtcgtcttgatatgcctttaactgacctaggcaaaaatcaagctaaaactgcttct
gaaaaattaattaaaatgaactataaatttgataaaataatttgctctccattaaaacga
gcaaaggaaaccgcaaacataataaatgaaaaatatcatttggaaattattgaaaatgat
ttgttaattgaacaagacaatggaatattgacaggtcaaaataagaaattaatggaaatt
aaatatccaataccaaaatttataaatccatttagaaaatttcctgaaaacactggcgaa
agcgattttgaattacatgcaagagcaggatttgcattaaattctttaatggataataaa
cctggaacatatttaattgtttcgcatggtagaattttaaatgcattaattagaaatata
ttacaaattccaataccgataaataatacaggagtatattttggatttggagatattgga
ttaattgatttaatttataaagaagatgaacataaatggtttttaatgaagtttgaggaa
agtttgtcctaa

DBGET integrated database retrieval system