KEGG   Treponema caldaria: Spica_1782Help
Entry
Spica_1782        CDS       T01573                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
scd  Treponema caldaria
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:scd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Spica_1782
   01230 Biosynthesis of amino acids
    Spica_1782
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spica_1782
  Energy metabolism
   00680 Methane metabolism
    Spica_1782
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spica_1782
Enzymes [BR:scd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Spica_1782
Exosome [BR:scd04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Spica_1782
  Exosomal proteins of melanoma cells
   Spica_1782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1962921..1963532
Genome map
AA seq 203 aa AA seqDB search
MYSFIFIRHGHSQADVENAFEGRLDMPLTDLGKNQAKTASEKLIKMNYKFDKIICSPLKR
AKETANIINEKYHLEIIENDLLIEQDNGILTGQNKKLMEIKYPIPKFINPFRKFPENTGE
SDFELHARAGFALNSLMDNKPGTYLIVSHGRILNALIRNILQIPIPINNTGVYFGFGDIG
LIDLIYKEDEHKWFLMKFEESLS
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtattcatttattttcattagacatggtcattctcaagctgatgttgaaaatgcattt
gagggtcgtcttgatatgcctttaactgacctaggcaaaaatcaagctaaaactgcttct
gaaaaattaattaaaatgaactataaatttgataaaataatttgctctccattaaaacga
gcaaaggaaaccgcaaacataataaatgaaaaatatcatttggaaattattgaaaatgat
ttgttaattgaacaagacaatggaatattgacaggtcaaaataagaaattaatggaaatt
aaatatccaataccaaaatttataaatccatttagaaaatttcctgaaaacactggcgaa
agcgattttgaattacatgcaagagcaggatttgcattaaattctttaatggataataaa
cctggaacatatttaattgtttcgcatggtagaattttaaatgcattaattagaaatata
ttacaaattccaataccgataaataatacaggagtatattttggatttggagatattgga
ttaattgatttaatttataaagaagatgaacataaatggtttttaatgaagtttgaggaa
agtttgtcctaa

DBGET integrated database retrieval system