KEGG   Treponema caldaria: Spica_1933Help
Entry
Spica_1933        CDS       T01573                                 

Definition
glycoside hydrolase family protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
scd  Treponema caldaria
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Spica_1933
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Spica_1933
Enzymes [BR:scd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Spica_1933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2145388..2147202)
Genome map
AA seq 604 aa AA seqDB search
MAAYASVPAIIPKPAFYQETGDRLYAATLTLDGDSFFLPQLRALRDEIITAFGETVLSPL
SSAEEFAYFEQQTHDETPLWGANFRRDAAPTIALHIHQVDERSWVEQARMHGSELADGVG
AVVWGAYLLTISPSGIEMVIPRTAGRNTMVESAAAAFATLMQLLHLGWDGWRFKLPVCTI
VDRPALAWRGLMIDSARHFVPVPELKKILSMAWLYKLNRFHWHLTDDQGWRLELVTLPEA
TGSGSTRPGGDPNRNGYYTQEEVRDIVAFAGDRGITVIPELDLPGHVQAILAGHPEFACT
PGPHYVRTEWGISEDVLCMGNPAALNFALKAWDEVCELFPGPYVHIGGDEVPTTRWESCP
KCAAKKAELGLTDWIDLHGYFVATIAEHLSKKGKIVFGWDEVLDSSIPNLANVVHWRAWI
PEQSTKALSQGRWLVRSPYFPYYLDFVQTDDRSISPGLAYRNPDAASLRRIYEYDPFEEI
EPDIPESVSGTETAQCSASGREAYLEGVPEQDAGQGRALENASLDRSGRFLGIQANAWTE
YIRDGRRLEYMLFPRLLALAETAWNGRTRSSYEDFLRRLEAGHCGSSRGIFAQRGINFCP
LYKD
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggctgcctatgcatctgtgccggcaataatccccaagccggcgttttaccaggaaacc
ggagacaggctgtatgccgctaccctgaccctcgacggcgattcgttttttctgccccag
ctccgggctcttcgggatgaaattataacagcctttggcgagacggttctgagtccctta
agttctgctgaggaattcgcctacttcgaacagcagacccatgacgaaactcccctctgg
ggtgccaatttcagacgggatgccgctcctacgattgcccttcatattcatcaggttgat
gaacgaagctgggtggagcaggcccgcatgcacggttcagagctcgcggatggtgttgga
gcagtggtctggggagcctatctgcttacaatttccccttctggaatagaaatggtaatt
cctcgcacagcaggacgcaacaccatggtagaaagcgccgctgcagccttcgcgaccctg
atgcagctgctccacctgggatgggacggctggcgtttcaagcttccggtctgtaccatt
gtggacagaccagcacttgcatggcgggggctcatgatagattctgcccgtcactttgtg
ccggttcctgaacttaaaaaaatcctcagcatggcctggctttataagctgaaccgcttt
cactggcaccttaccgatgaccagggctggcgactggagcttgtaaccctgccagaagcc
actggttccggttccacaagacccggcggcgatccgaaccggaacggctattatacccag
gaagaggtccgggatattgtggcctttgcaggggatcggggaattacggtgattcccgaa
ctggacctgcccggccatgtccaggcaatcctggcaggacacccggagtttgcctgtaca
ccggggccccattatgttcggaccgaatggggcatttcggaggatgtactctgtatggga
aaccccgccgccctaaattttgccctgaaagcctgggatgaggtctgcgaactctttccg
ggcccctatgtccatatcggcggtgatgaagtgcccaccacccggtgggaaagctgtccg
aaatgcgctgcaaaaaaagcagagctgggtcttacagactggatcgatctgcatggttat
tttgtggcaaccattgcagagcacctgagcaaaaagggaaaaatagtctttggatgggat
gaggtgctcgactcatcaatcccgaacctggccaatgtggttcactggcgggcctggatc
ccagaacagtcgactaaggccctttctcaaggccgctggcttgtccgcagtccttatttt
ccctattacctagattttgtgcaaaccgatgatcgcagtataagccctgggcttgcctac
cgtaatcccgatgccgcgagcctccgccgcatctatgagtacgacccctttgaggaaatt
gaaccggatatccctgagtctgtatcgggaacggaaacggcccagtgcagtgcatcggga
agagaagcgtacctggaaggtgtaccggaacaagatgcaggccaggggagagcgcttgaa
aatgcatccctggaccgaagcggtcgtttcctgggcatacaggctaacgcctggaccgaa
tacatccgggatggccggcggcttgaatacatgctctttccccggctccttgctctggca
gagaccgcctggaacggcagaacccgcagttcctatgaggacttccttcggcggctggag
gctgggcactgcggttcgagccggggaatttttgcccagcggggcatcaatttttgcccc
ctgtataaagactga

DBGET integrated database retrieval system