KEGG   Treponema caldaria: Spica_2066Help
Entry
Spica_2066        CDS       T01573                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
scd  Treponema caldaria
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:scd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Spica_2066
   01230 Biosynthesis of amino acids
    Spica_2066
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spica_2066
   00030 Pentose phosphate pathway
    Spica_2066
   00051 Fructose and mannose metabolism
    Spica_2066
   00052 Galactose metabolism
    Spica_2066
  Energy metabolism
   00680 Methane metabolism
    Spica_2066
Enzymes [BR:scd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Spica_2066
Protein phosphatases and associated proteins [BR:scd01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Spica_2066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2318834..2319940)
Genome map
AA seq 368 aa AA seqDB search
MGDRKKSVTKTIGILTSGGDCPGLNAAIRGVCRAAYDRYNMSIIGIANGYRGLIDGDARL
LRPEDFSGILTRGGTILGTSREKPFKSRNGEYDADVGQDKVEVIKENYKKLNLDCLVVLG
GNGTNTTGYLLSQEGLNVIGLPKTIDNDIVGTDMTFGFHSAVSIATEAIDRLHSTAHSHN
RVMVIELMGHKAGWLSLYAGVAGGGDIILIPEIPYDIDAIGRHLLKRARDGKSFSIVVVA
EGAQSVEEAKMDKKERKKYREKTAKPSIGYRVAREIEAETGMETRVTVLGYLQRGGIPSA
WDRVLATTFGTAAAELLARGEYGKMVSLKGNEVGSVDLSEPAGRVKTVPEDHYMIDTARS
VGTCLGNE
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgggagatcgcaagaaaagtgtcacgaagaccataggaattcttacctccggcggggat
tgccccggccttaacgccgccatccggggcgtgtgccgggcagcctatgaccgctataac
atgagcatcattgggatcgctaatgggtaccgtggattgatcgatggtgacgctcgactc
ctgaggcctgaagatttttctggtattctaacccggggcggtaccattcttggaactagt
agggaaaagccctttaagtcccgaaatggcgagtatgatgccgatgtgggacaggacaag
gtagaagtaattaaagaaaattataaaaagttaaatctggactgtcttgtggtcctgggc
ggaaatggaaccaatactacggggtatctgctttcccaggaaggactgaatgtgatcggt
ctccccaaaacgatagataacgatattgtcggcaccgatatgacctttggcttccattct
gccgtatcaatcgccaccgaagccatcgaccgcctgcattccaccgcccatagccataac
cgggtcatggtgattgaacttatggggcataaggcgggctggctctccctgtatgcaggg
gtcgctggcggcggggacattatccttatccctgagattccctatgatatcgatgccata
ggccggcacctcttaaagcgggctcgggacggcaagagcttctccatagtggttgtagcc
gaaggggcccagtcggtagaagaagcaaaaatggataagaaggaacggaaaaagtaccgt
gaaaagaccgcaaagccttccatcggctaccgggtagcccgggaaattgaagcagaaacg
ggaatggaaacccgggttaccgttttaggttacctccagcggggcggtatacccagcgcc
tgggaccgggtcctggccaccacctttggaaccgccgctgcggaactccttgcccggggt
gaatacggcaaaatggtcagccttaagggtaatgaagtaggttcagtagacctgagcgag
cccgcagggcgggttaaaacggttcccgaagaccactacatgatcgacaccgcccgatca
gttggtacctgtctgggtaatgaatag

DBGET integrated database retrieval system