KEGG   Treponema caldarium: Spica_2066Help
Entry
Spica_2066        CDS       T01573                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
scd  Treponema caldarium
Pathway
scd00010  Glycolysis / Gluconeogenesis
scd00030  Pentose phosphate pathway
scd00051  Fructose and mannose metabolism
scd00052  Galactose metabolism
scd00680  Methane metabolism
scd01100  Metabolic pathways
scd01110  Biosynthesis of secondary metabolites
scd01120  Microbial metabolism in diverse environments
scd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:scd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spica_2066
   00030 Pentose phosphate pathway
    Spica_2066
   00051 Fructose and mannose metabolism
    Spica_2066
   00052 Galactose metabolism
    Spica_2066
  Energy metabolism
   00680 Methane metabolism
    Spica_2066
Enzymes [BR:scd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Spica_2066
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Spica_2066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AEJ20193
JGI: Spica_2066
UniProt: F8EZH0
Position
complement(2318834..2319940)
Genome map
AA seq 368 aa AA seqDB search
MGDRKKSVTKTIGILTSGGDCPGLNAAIRGVCRAAYDRYNMSIIGIANGYRGLIDGDARL
LRPEDFSGILTRGGTILGTSREKPFKSRNGEYDADVGQDKVEVIKENYKKLNLDCLVVLG
GNGTNTTGYLLSQEGLNVIGLPKTIDNDIVGTDMTFGFHSAVSIATEAIDRLHSTAHSHN
RVMVIELMGHKAGWLSLYAGVAGGGDIILIPEIPYDIDAIGRHLLKRARDGKSFSIVVVA
EGAQSVEEAKMDKKERKKYREKTAKPSIGYRVAREIEAETGMETRVTVLGYLQRGGIPSA
WDRVLATTFGTAAAELLARGEYGKMVSLKGNEVGSVDLSEPAGRVKTVPEDHYMIDTARS
VGTCLGNE
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgggagatcgcaagaaaagtgtcacgaagaccataggaattcttacctccggcggggat
tgccccggccttaacgccgccatccggggcgtgtgccgggcagcctatgaccgctataac
atgagcatcattgggatcgctaatgggtaccgtggattgatcgatggtgacgctcgactc
ctgaggcctgaagatttttctggtattctaacccggggcggtaccattcttggaactagt
agggaaaagccctttaagtcccgaaatggcgagtatgatgccgatgtgggacaggacaag
gtagaagtaattaaagaaaattataaaaagttaaatctggactgtcttgtggtcctgggc
ggaaatggaaccaatactacggggtatctgctttcccaggaaggactgaatgtgatcggt
ctccccaaaacgatagataacgatattgtcggcaccgatatgacctttggcttccattct
gccgtatcaatcgccaccgaagccatcgaccgcctgcattccaccgcccatagccataac
cgggtcatggtgattgaacttatggggcataaggcgggctggctctccctgtatgcaggg
gtcgctggcggcggggacattatccttatccctgagattccctatgatatcgatgccata
ggccggcacctcttaaagcgggctcgggacggcaagagcttctccatagtggttgtagcc
gaaggggcccagtcggtagaagaagcaaaaatggataagaaggaacggaaaaagtaccgt
gaaaagaccgcaaagccttccatcggctaccgggtagcccgggaaattgaagcagaaacg
ggaatggaaacccgggttaccgttttaggttacctccagcggggcggtatacccagcgcc
tgggaccgggtcctggccaccacctttggaaccgccgctgcggaactccttgcccggggt
gaatacggcaaaatggtcagccttaagggtaatgaagtaggttcagtagacctgagcgag
cccgcagggcgggttaaaacggttcccgaagaccactacatgatcgacaccgcccgatca
gttggtacctgtctgggtaatgaatag

DBGET integrated database retrieval system