KEGG   Treponema caldaria: Spica_2096Help
Entry
Spica_2096        CDS       T01573                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
scd  Treponema caldaria
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:scd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Spica_2096
   00052 Galactose metabolism
    Spica_2096
   00500 Starch and sucrose metabolism
    Spica_2096
   00520 Amino sugar and nucleotide sugar metabolism
    Spica_2096
Enzymes [BR:scd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Spica_2096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2359310..2360167)
Genome map
AA seq 285 aa AA seqDB search
MKGIIVAAGYGTRFLPVTKTIPKEMLPVVNVPSIAFIVDEFVKSGIEDIIIISSRRKKVL
EDYFDREIELESVFEKEGKLDRLERIKPPVNVRFAFVRQQRMLGTGHALLQVKELVGNDA
CVVAYPDDLHIGEPPLAAQLMASWRETGCSVMASVYEPGDVSRYGVLDIAADGKHVRAIV
EKPSRGTEPSHEVSIGRYLYTPEFFHYLAEGWERHEGGEYYHIYALNKLMNEGKVVYRRL
SGQRLDTGEPEGYLDAILRYADTVPSLRKVLDSYMTERKGSIVKS
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaattattgttgctgcaggttatgggacacgctttttaccggtcaccaaaact
ataccaaaggaaatgttgccggtagttaatgtaccgtctatagcctttattgttgatgaa
tttgtaaagtctggtatcgaagatattatcattatcagttcacggagaaaaaaggttctg
gaagactattttgatcgggaaattgaactggaatcggtgttcgaaaaagaaggtaaactt
gaccggctggaacggattaaaccaccggtaaatgtccgttttgcctttgtccggcagcag
cggatgctgggcaccggacacgctctgctgcaagtcaaggagctcgttggaaacgatgcc
tgtgtcgttgcctatcctgatgaccttcatatcggtgagcctcccctggcggctcagctt
atggctagctggcgtgaaactggctgttctgtaatggcgagcgtttatgagccgggagat
gtgagtcgttatggcgttttagatatagccgctgacggtaagcatgtacgggctattgtg
gaaaaacccagccggggcacagaaccaagtcatgaagtgtctataggccgttacttatac
accccagagttctttcattatctggcagaaggctgggaacggcatgagggtggcgagtac
tatcatatctatgcgctcaataaattgatgaatgaagggaaggtggtgtaccgccgactt
tccggtcagcggcttgatacgggtgagcctgaaggctatctggatgctatcctccgctat
gccgatacggtaccttctcttcggaaggtcctcgattcttatatgactgaacggaaaggg
agtattgttaaaagttag

DBGET integrated database retrieval system