KEGG   Spirochaeta caldaria DSM 7334: Spica_2177Help
Entry
Spica_2177        CDS       T01573                                 

Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
scd  Spirochaeta caldaria DSM 7334
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:scd00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:scd00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2449900..2451282)
Genome map
AA seq 460 aa AA seqDB search
MQIRELIETAKDTDRLLSPLEAAERQVKTPKHLSCIINVDTEKTYQTIMGFGGALTESSG
YVLASLSAADREAVLKAYFSASEGLGYTFARTHLNSCDFSLGNWACLESRDESLASFSMA
MPERYQIPLLKDAFRAAGGHLSLLLSPWSPPAWMKDNNDMNHGGKLLRQYYPLWASYFVR
YIDELAKRDIPVWAVSIQNEPEATQIWDSCIWTAREEAEFAVEHLGPALEKAGYGHIKIL
VWDHNRDRLWERASESYAYGGAEKYIAGAAYHWYSGDQYDAVRRVAEAYPDKLLVFSEGC
VEGGPRPGAWFTGERYAHNIINDLNNGCQAWIDWNIALDFTGGPNHVGNLCDAPILVDTE
QGRAYYQSSFYYIGHFSRYIRPGARRLGLRMDSWMVPAAVDGRMGNTMEACAARNTDGTI
SLVVSNRTEADMVYRLSLSGDQEERTLVCPPRGIQTLVLG
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgcagatacgtgagcttatagaaacagcaaaggatacggaccggctgctttccccccta
gaggcggcggagcggcaggtaaaaaccccaaagcacctttcatgtatcatcaatgtggat
acagaaaagacctatcagacgattatgggttttggcggcgcactgaccgaatcctctggc
tatgtgcttgcaagcctttcagcggcagaccgggaagcggtgctgaaggcctatttttct
gccagtgaaggtctgggctatacctttgcccggacacacctgaatagctgcgatttttcc
ctgggcaactgggcctgtttggaaagcagggatgaaagcctcgcatccttctctatggcc
atgcctgagcgctaccaaatcccccttttaaaagacgccttccgggccgccggcggccac
ctgtcccttcttctttcgccctggagtccccccgcctggatgaaggataacaacgacatg
aaccatggcggaaagctgttgcggcagtactaccccctctgggcttcttattttgtccgt
tatattgatgaattggcaaagcgggatataccggtctgggcagtttcgatacaaaatgag
cctgaggcaacacaaatatgggattcctgcatttggaccgcccgggaagaggctgaattt
gccgtagaacatctggggccggccctggaaaaggcgggctatgggcacatcaaaattctc
gtgtgggaccataaccgggaccggctctgggaacgagccagcgaaagctatgcctacggc
ggtgcagaaaagtacattgccggtgcggcctaccactggtattccggggatcagtatgat
gcggttcgccgggtggcagaggcgtaccccgacaaattacttgtcttttccgaaggctgt
gtagaagggggcccccggcctggggcctggttcaccggcgaacggtatgcccataatatc
attaacgatttgaacaacggctgtcaggcctggatcgactggaatattgccttggatttt
acggggggccccaaccatgtggggaacctctgtgatgcaccgatattggtggatacggag
cagggcagggcttactatcaaagttctttctattatataggacacttcagccgctatatc
agacccggtgcccgtcggcttggccttcgcatggattcctggatggtccccgctgcggtc
gacggccggatgggcaataccatggaagcctgtgccgccaggaacaccgatggtaccatc
agcctggtagtgagcaaccgaaccgaagctgacatggtgtaccggctctccctttcagga
gaccaggaagaacgcaccctggtgtgtccgccccggggtattcagaccctggtgttaggc
taa

DBGET integrated database retrieval system