KEGG   Spirochaeta caldaria DSM 7334: Spica_2242Help
Entry
Spica_2242        CDS       T01573                                 

Definition
L-fucose isomerase (EC:5.3.1.25)
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
scd  Spirochaeta caldaria DSM 7334
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:scd00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2518069..2519889)
Genome map
AA seq 606 aa AA seqDB search
MADIASLKMNPPEQRYRGELPKIGIRPTIDGRLGGVRESLEEVTMGMAKAAAALIQSKLR
HPNGMPVQCVIADTTIGGVAEAAACADKFRRENVSVTLTVTPCWCYGSETMDMDPLTIKA
VWGFNGTDRPGAVYLAAVLAAHNQKGLPAFGIYGHDVQDLQDTDKIPADVEEKILRFARA
GIAAAWMRGKSYLSIGSVSMGIAGSIVNPDFFQDYLGMRTEYVDMSELVRRFEEKIYSEA
EYKRALEWVRENCKEGPDINPPEKQHNRKKKDEVWSTSVKMAMIVRDLMVGNSDLKRKGL
YEEALGHNALLAGFQGQRHWTDHFPNGDFLETILNSSFDWNGIRSPYLVATENDSLNGAA
MLFGHLLTGTAQIFSDVRTYWSPEAVQRVTGWKPEGVAAQGFIHLINSGATTMDGTGKQR
RDGKPAMKPFWEITPEEAGACLDATLWRYADLGYFRGGGYSSDFLTEGGMPVTMSRINLV
KGLGPVLQIAEGVTATLPEDVHNKLDKRTNETWPTTWFVPRLTGNGPFKDVYSVMAAWGA
NHGAISYGHIGADLITLASILRIPVCMHNVDISRVYRPSYWSAFGMDSEGSDYRACQILG
PLYGNA
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atggcagatatagccagtttaaaaatgaatccaccggagcaacggtatcggggggaactt
cccaaaatcggtatacgtcccacaatcgatggccggcttggcggcgtgcgggaatccctg
gaagaggtgaccatgggaatggccaaggctgcagcggccttgattcagtcgaaactgcga
catcccaatggcatgcccgtacagtgtgtgattgcggacaccactattgggggggtagca
gaagccgcggcctgcgcggacaaattcagacgggaaaatgtgtcggtaaccctaaccgtt
actccctgctggtgctacggctctgaaaccatggatatggaccccctgaccattaaagcc
gtgtggggctttaatggcaccgaccggccaggggcggtgtacctggcggcagtattggca
gcccataaccagaagggtctgcctgcctttggcatctatggccacgatgtgcaggatctg
caggatacggataaaatacccgccgatgtggaagaaaaaatcctccgttttgcccgtgca
ggtattgccgccgcctggatgcggggaaagagctacctttccatcggttccgtttccatg
ggcatcgctggctccattgtaaatccggactttttccaggactatctggggatgcggacc
gagtatgtcgatatgagcgaactggtccggcgttttgaggaaaagatttacagcgaagcc
gaatataaacgggctctggaatgggttcgggaaaactgcaaggaaggaccggatatcaat
ccgccggaaaaacagcacaaccgcaaaaaaaaagatgaggtctggtctaccagtgtaaaa
atggccatgattgttcgggatctgatggttggaaattctgacctgaaacggaaaggcctc
tatgaagaagccctgggacataatgctcttttggctggcttccagggacagcggcattgg
acagaccatttccccaatggggacttccttgaaactattttaaattcatcctttgattgg
aacggaatccgcagtccctatctggtagcaacggaaaatgactccctgaacggagcggct
atgctcttcgggcatctccttaccggaacagcccagatattctccgatgtgcggacctat
tggagtcccgaagcggtccagcgagttacgggatggaaacctgagggcgtcgcggcccag
gggttcatccacctgataaactcaggggctacgaccatggatgggaccggcaaacagcgc
agggatggcaagcctgccatgaaacccttctgggaaattacccccgaagaggctggggct
tgcctggatgccaccctctggcgttatgcagacctgggctacttccggggcggcggctac
tcatcggatttcttaaccgaaggcggaatgccggtgaccatgagtcgcatcaatctggta
aagggccttgggccggtactgcaaatagccgaaggggtcaccgccaccttgccggaggat
gtccataataagcttgataagcggaccaatgaaacctggccaactacctggtttgttccg
cggcttacaggcaatggtccctttaaggatgtctactcggttatggctgcctggggcgcg
aaccatggggcaatcagctacggtcacattggggctgacctgattaccctggcttccatc
ctgcggatccctgtctgtatgcacaatgtggacatcagtagggtgtaccgccccagttat
tggagtgcctttggtatggacagtgaaggttccgattaccgggcatgtcagatccttggg
cctctatatggaaatgcataa

DBGET integrated database retrieval system