KEGG   Spirochaeta caldaria DSM 7334: Spica_2490Help
Entry
Spica_2490        CDS       T01573                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
scd  Spirochaeta caldaria DSM 7334
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:scd00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:scd00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:scd00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2807947..2809881
Genome map
AA seq 644 aa AA seqDB search
MEIHGIERHIEASTQKQSVQTIRYRVGSPEAIREAQSNDENIALLVDYLSFEEVAQLIQA
DSNFVKALSKTNKLAIHPGGWQSWSAGWELVGRESLPRKVHVVPELLKFTNRDGDNPGKG
EILGHFIMYIRSGSTYLCLASKEGGSLPPVTYRIDRKAGRIAIEVFARGKTWKAGETIAE
LSIFLAGNFFQLKDTLRRLYKNEEQFYALSFVRQGSGKKRIQPTDSQGTVSPWITKKDMP
GGFESWYNHYTDINEKLILEDLESLGTTDNLIKLQYIDRNRPTIFQIDDGWEKAVGHWEI
DPQRFPHGLKPIAEAIEKKGYIPGLWLAPFLITRKSPVFTEHPDWVLKDEQGELVVAGYN
DLWDKQFYCLDLSLPAVQEYLDQLMDRAINEWGYRYLKLDFLYAGLLHGAFAKGGSAYEH
YDGACKILTSRQGTRSGLPVAYLGCGVPFGPSYKYFPLSRIGADTKEQWDWLKVRLVGHV
GRPSAYVSLHDTIGRSYLDNTLFVNDPDVVFLRTHNCKLTEQEKEVVALTNFMLASQVMF
SDDPTQLSQEDIELTKRISRLYDELSDDEYGVIRIQRDVFHVFSRSGAIQGLINLSNRSA
RIHRSQASELFACIESGRPLINHIQRQGRDSAAFTSHSITIFRK
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggaaatccatggcattgaacggcacatagaagcttctacacagaaacaatctgtacaa
accatccggtacagagttggatccccagaagcgatacgggaagctcaaagcaatgatgaa
aatatagcattgctcgttgattacctcagttttgaggaagtggcacaacttattcaagcg
gatagcaattttgtaaaagcattatcaaaaaccaataaactggcaattcatcctggaggc
tggcaatcctggtcagccggatgggaattagttggcagagaatccttacctcgcaaagtt
catgttgttccggaactgctcaaatttaccaatcgggatggagataatcctggtaaagga
gaaattctgggccatttcatcatgtatattcgttccggctccacctatctctgtttagct
tcgaaagaaggaggatctctgccgcctgtcacataccggatcgacagaaaagcgggtcgt
attgcgatagaagtatttgcccgggggaaaacctggaaagctggtgaaaccatcgctgaa
ctttctatcttccttgctggtaatttcttccagcttaaggatacgctccgtcgtctttat
aagaatgaagaacaattttatgccctcagttttgtacgtcagggttctgggaaaaagcgc
atccaacctaccgattcacagggcactgttagtccctggattaccaaaaaagatatgccc
ggtggttttgaatcctggtataaccattacaccgacattaatgaaaagctgattctggaa
gaccttgaaagtcttgggacaaccgataacttaattaagttacaatatatcgatcgtaat
agaccaacgatattccagattgatgacggctgggaaaaggcggttggccactgggaaata
gatccacagcgttttccccatgggcttaagcccatcgcagaagccatagaaaagaaaggt
tacattcccggtctctggcttgcccccttcctcataacgcgaaagtctccggttttcaca
gaacaccccgattgggtattaaaggacgaacagggggaacttgtggttgcgggctacaac
gatctgtgggacaaacagttctactgtctggatctttccctgccggctgtacaagagtac
ctggatcagctcatggaccgggctattaatgaatggggctaccgctacctcaagctcgat
ttcctctatgcagggctcttgcatggggcctttgcgaaggggggctccgcctatgaacac
tatgatggggcctgcaaaattctcacatcccgtcagggaacaaggtcgggacttcctgtt
gcctacctgggttgcggggtgccctttgggccctcatataagtatttccccctttcccgc
atcggggctgataccaaagaacagtgggactggcttaaggtacgcctcgtcgggcatgtg
ggacggccttcggcctatgtcagtcttcatgataccataggccgctcatatctggataac
accctttttgttaatgatccggatgtggtattcctgcggacccataattgtaaactgact
gaacaggaaaaagaggttgtcgcccttaccaactttatgcttgcaagccaggtgatgttc
tccgatgacccgacccagctttcccaggaagatattgaattaactaaacggatttctcgc
ctctatgatgaactctcagatgatgaatacggggttatccggatacagcgggatgtattc
catgtattcagccgcagtggcgcaatccaggggctcatcaacctgtcgaacagatcagcc
agaatacaccgaagccaggcttcagaactgtttgcatgtatcgaatcaggccggccgctc
atcaaccatatacaacgacaaggacgagattcggccgcctttacgtcacacagcatcacc
attttcaggaaatag

DBGET integrated database retrieval system