KEGG   Spirochaeta caldaria DSM 7334: Spica_2614Help
Entry
Spica_2614        CDS       T01573                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
scd  Spirochaeta caldaria DSM 7334
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:scd00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2962370..2964346
Genome map
AA seq 658 aa AA seqDB search
MHLSNQTKRLTGVAVPLGALKTQHSIGVGEFPDLVELAHLCKSCGIGLIQLLPVNDSGFQ
SSPYSALTAFALHPLYLRISDMEEASGFEKKLQELKARFENLPRFAYGPLQDAKLALLRE
IFQKNKKKIFANAEPGKKLHTWIQQNPWIIDYAVYRRLKDVHHGAHWNAWNYYKEVKDKL
IQELWDNSEYKEEHLFWVWIQAALDHQFTKAAQTIRDMGIILKGDIPILMNEDSADVWAH
SELFYRDLSAGAPPEPLNPLGQNWQFPIYNWDALEKSGFAWWIHRLRLASRYYSAFRIDH
VLGFFRIWATSRKNMSAALGHFVPSVPITTEELSNLGFDDSRIRWLVQPHIPTHELFEAM
QGDPTTEAAVRKACAKALTRIGNEELWLFNNAISGEIDIQALDIHHSLKEYLLRAWRNRV
LIPQEDKTYYPSWTYWDTRAFPTLSESERRNLESLIQQKRLESEQLWEDQGRKLLSTFLH
ATDMIPCAEDLGTIPECVPRVLQELGILSLKIVRWTRRWGEWGEPYIPFTEYPELSVCTP
AVHDTSTVRQWWETEADREQFRQFINVPYINDRYTPETAELLFSHIMQTRSRFCIFQIQD
LLHLSLQWYAEDPEDERINVPGSVNDFNWTYRLPSTLETIQKDETFIAACKRLTSNRR
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgcatctttcgaatcagactaaacggcttaccggtgttgcagtaccgttaggggctttg
aaaacccagcacagtattggggttggagagtttccggacctggtagaacttgctcatctt
tgtaaatcctgtggcattggactgattcaactgttgccagtaaacgattcaggctttcaa
agttctccctatagtgcactgacagcctttgcactgcatcctctatatctccgtatcagc
gatatggaagaagcctcgggctttgaaaaaaaactacaagaactcaaagctcgcttcgaa
aaccttccccgtttcgcttacggccccctccaggatgctaaattggcactactgcgggaa
atcttccagaaaaacaagaaaaaaatcttcgcgaatgccgaaccaggcaaaaaactacat
acctggatacagcaaaacccctggattatcgattacgcggtgtaccggcgccttaaagat
gtgcaccatggggcgcactggaatgcatggaattactataaagaagtgaaggataaactc
atccaggagttatgggacaactctgagtataaagaagaacaccttttttgggtttggata
caggcagccctggaccatcaatttaccaaggcggctcaaacgatccgggacatgggtatt
attctaaaaggagatattcccatattgatgaatgaagactcggccgatgtctgggcccat
agtgaattattctatcgggacctttccgcaggggcaccaccagaaccccttaatcctctg
ggacaaaactggcaatttcccatctataattgggacgccctcgagaaatcgggctttgct
tggtggatacatagactccgcctcgcctcccgttattacagtgccttcagaattgaccat
gtactaggatttttccgaatctgggctacatcccgtaaaaatatgtccgcagctctggga
cactttgtcccatcggtaccaattaccactgaagaactctctaaccttggattcgatgac
agccgtatcagatggctcgtccaaccacacattcctactcatgaattattcgaagccatg
cagggagacccgactaccgaggctgcggtacgaaaagcctgtgccaaagcactgacccgg
ataggcaatgaagaactctggctttttaacaatgctatatcaggagaaatcgatatacag
gctctggatatccatcattcactaaaagaatatcttttaagagcctggagaaatcgggtt
ctcattccacaagaggataaaacctactatccaagctggacttactgggatacccgtgcc
tttccaaccctttcagaatcggaacgacggaatcttgaaagcctcattcagcaaaaacgg
cttgaatcagaacagctttgggaagaccagggcaggaagctcctctccacctttctgcat
gctaccgatatgataccttgtgcagaagatttaggtacaattccggagtgcgttcctagg
gtactgcaggagttaggcatattgagcttaaaaattgtgcgatggacccgccgttggggt
gaatggggagagccctatattccttttaccgaatatcctgaattatctgtctgcacaccc
gcagtacatgatacttcaacggttcggcaatggtgggaaaccgaagctgaccgtgaacag
ttccgtcagttcatcaatgtaccctacataaatgaccgctataccccagaaaccgctgaa
cttctgttcagccacatcatgcaaactagatctcgattctgcatttttcagattcaggac
ctgttgcacctttcacttcaatggtatgccgaggatcctgaggatgaacggatcaatgtc
ccgggtagtgtaaatgactttaactggacctatcgcctgcccagcacattagaaaccatt
caaaaagatgagacgtttattgcagcctgtaaaaggcttacttcaaatcgaaggtga

DBGET integrated database retrieval system