KEGG   Treponema caldaria: Spica_2617Help
Entry
Spica_2617        CDS       T01573                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
scd  Treponema caldaria
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:scd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Spica_2617
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spica_2617
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Spica_2617
Enzymes [BR:scd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Spica_2617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2969317..2970621)
Genome map
AA seq 434 aa AA seqDB search
MEFSSTRSKELRVSFRDAVLHCLPSDGGLYVPASMVDLRPFFLYMDSETTYPELVATIAP
VLLQGELNPISAARVAESAFSFEPELKRLDANLSVLELHNGPTGVFKDFGIAFLAAVMEE
LLKPSGHAMTLTATTGRTGVSVAQAFKGRTGITAVILYPEGHVRGLDPSTFVNNGGNILP
IQIEGTFDDCQRLIRDAFEDRPFAERYGLTSANTINVGRLLPQAFYFLYAFIKIKKELHG
DLLFSVPSGNFGNLIAGLYAWKFGLPVNGFIAAMNANDTFGDFFRGQSFVPHIPVRTLSR
SMDVGNPSNYERLAAFYNEAPAVMKHMVYSERVDDEATLAAMERAWKRYGLHLDPHGAVG
FAAAERLLAGDIEDGHVVVLSTGHPAKYADLVARVTGKAPITSEVLENLQKEVAPVAVIP
ARLDALESAIAGAL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggaattttcttctacccgttcaaaggaattgagggtcagctttagggatgcggttttg
cactgtcttccatccgatggggggctttatgtgcctgcatctatggtagatctgcggcct
tttttcctttatatggatagcgaaactacctaccccgaattggttgctactatagctccg
gttttattgcagggcgagctcaatcccatttccgctgctcgggtcgcagaaagtgctttt
agtttcgagcctgagttaaagcggctcgatgccaatttatcggtcctagaacttcataat
ggacccaccggagtgtttaaagattttggtattgcctttcttgcggctgttatggaagaa
ctgttaaagccttcaggtcatgcgatgaccttaacagctaccactggccgtactggtgtt
agtgtcgcccaagcattcaaaggcagaacaggaattacagcggtaatattataccccgaa
ggccatgtgcggggtttagacccatcaacctttgtgaacaacgggggtaacatacttccc
atacaaattgaaggcaccttcgatgattgtcagcgccttatccgagatgcttttgaagat
cggccctttgcggagcgctatggtcttaccagtgcgaataccattaatgtggggcgcctg
ttaccccaagctttttatttcctctatgcgttcatcaaaattaaaaaggaactgcatggt
gatctattattcagtgtgccttcaggtaattttgggaacctcatcgcagggctctatgct
tggaaattcgggcttccagtgaacggatttattgctgcgatgaacgccaacgataccttt
ggtgatttcttccggggacaatcctttgttcctcatataccggtacgtacgttatccagg
tcgatggatgtggggaatccctctaactatgagcggcttgctgccttttataatgaggct
ccggcggtaatgaaacatatggtctattccgaacgagttgatgatgaggccaccctggcg
gcgatggaacgggcttggaaacggtatggtctccacctagacccccatggggcggtgggt
tttgctgcggcggaacggcttcttgccggtgatattgaggatggccatgtggtagtcctt
tcaacggggcaccctgcaaaatatgctgatcttgttgccagggtaaccggcaaagcgccg
ataacctcagaagtactggaaaaccttcaaaaagaagtagcccctgttgcggttattccg
gcccgtctcgatgctcttgaatcggcaattgcaggagctttgtaa

DBGET integrated database retrieval system