KEGG   Treponema caldaria: Spica_2845Help
Entry
Spica_2845        CDS       T01573                                 

Definition
2-dehydropantoate 2-reductase (EC:1.1.1.169)
Orthology
K00077  
2-dehydropantoate 2-reductase [EC:1.1.1.169]
Organism
scd  Treponema caldaria
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Spica_2845
Enzymes [BR:scd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.169  2-dehydropantoate 2-reductase
     Spica_2845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3211175..3212140
Genome map
AA seq 321 aa AA seqDB search
MKDIERVLVVGSGAVGTAIASIISEHIPGSVSVLADGERFERYNRDGFIVNGKTYHFPVI
SPVSTHSHYDLIIVAVKHHHLPEAIEQMKAHVGDNTSILSLMNGISSEEQLGARFGAGPG
APDGVRLPPYAMILGIDAVRIGNETRFASTGKIFFGEATNNTSALSPRIQRIAAFFEKAC
VPYEIPENMLRALWFKFMINVGINQASAILRAPYRLFQTNTNAKAVMETLQREVIALSQA
MGINLNEQDLVNWEKTLAGLHPDNLTSMCQDVLANRKTEVEMFAGTVVHLGKQYQVPTPA
NELVFNLIKAIEASYNPTVIP
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacattgaacgagtattggttgttgggtctggtgcggttggtaccgctattgct
tcaatcatttcagaacatataccgggttcagtctccgtacttgccgatggagaacgcttt
gaacggtataaccgggacggttttatcgtaaacgggaaaacctaccatttccccgtgata
tcccccgtttcaacccacagccactatgatcttattattgtagcggtgaaacatcatcat
cttccagaagctatcgaacaaatgaaagcccatgtaggggacaatactagtattctttcg
ttgatgaacggtatttccagcgaagaacagttgggagcccgatttggcgccgggcccggt
gcgcccgatggcgtccggcttcccccttatgctatgattttagggattgatgcggttcga
atcggcaatgaaacccgttttgcctctacaggaaaaatattttttggtgaagctactaac
aatacatcggccttaagtccccggatccagcggattgccgccttttttgaaaaagcctgc
gttccctatgaaattccagaaaacatgcttcgagcgctctggtttaaatttatgatcaat
gtgggcattaatcaggcctcagctatactccgtgcaccctaccggctgtttcagaccaac
actaacgccaaggctgttatggaaacccttcagcgggaggttattgctctctcccaggcc
atgggcattaacttgaacgaacaggacctcgtaaattgggaaaagaccctggcaggactg
catccagacaatctgacttccatgtgccaggatgtgctggcaaaccgtaaaacagaagtt
gagatgtttgccggaacagtggtccacctgggtaagcaatatcaggttcctacaccagcg
aacgaactggtctttaaccttatcaaagcaatcgaagcctcgtacaacccgacggttatc
ccttaa

DBGET integrated database retrieval system