KEGG   Saccharomyces cerevisiae (budding yeast): YEL036CHelp
Entry
YEL036C           CDS       T00005                                 

Gene name
ANP1, GEM3, MNN8
Definition
(RefSeq) Anp1p
  KO
K05533  mannan polymerase II complex ANP1 subunit [EC:2.4.1.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00513  Various types of N-glycan biosynthesis
sce01100  Metabolic pathways
Module
sce_M00074  N-glycan biosynthesis, high-mannose type
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    YEL036C (ANP1)
Enzymes [BR:sce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     YEL036C (ANP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Anp1 GldH_lipo Spt20 Suf
Motif
Other DBs
NCBI-GeneID: 856675
NCBI-ProteinID: NP_010878
SGD: S000000762
UniProt: P32629
Position
V:complement(83050..84552)
Genome map
AA seq 500 aa AA seqDB search
MKYNNRKLSFNPTTVSIAGTLLTVFFLTRLVLSFFSISLFQLVTFQGIFKPYVPDFKNTP
SVEFYDLRNYQGNKDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFLVS
DSSDNTMGVLLSNLQMAQSQQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKL
MARARNWLGSVALKPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGN
IQPYDLNSWKESEGGLQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDG
IGGVSILAKAKVFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSS
DDLKHMAWMAEEEKRKLEEERIREFYNKIWEIGFEDVRDQWNEERDSILKNIDSTLNNKV
TVDWSEEGDGSELVDSKGDFVSPNNQQQQQQQQQQQQQQQQQQQQQQLDGNPQGKPLDDN
DKNKKKHPKEVPLDFDPDRN
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaagtataataacagaaaactctcgttcaaccctaccacagtaagtatcgctggaacg
ttgcttacggtgttctttctcacaagactcgtgctttcgttcttctcgatatcgctattc
cagctggtaactttccaaggaatcttcaagccctatgttccagattttaaaaatactccc
agcgtagagttctacgacctacgaaattaccaaggcaacaaagatggttggcaacagggt
gaccgcatcttgttttgcgtgccactgagagatgcttctgagcatcttcccatgtttttt
aaccatctgaataccatgacatatccgcacaacctgattgatctgtcgtttttggtgagt
gactcttcggataacaccatgggcgtgttactatccaatctacagatggcgcaatcgcaa
caagacaagtccaaaaggtttggtaacatcgaaatctatgagaaggacttcggccaaatc
attggtcagtccttttctgatcgtcacgggtttggcgcccagggccccagaagaaagctg
atggccagggctcgtaattggcttgggtccgtggccctgaaaccataccactcctgggtt
tactggagagacgtggatgtcgaaaccatccccactaccatcatggaggatctaatgcat
cacgacaaggacgtcattgtccccaacgtctggagacctttaccagactggctgggaaac
attcaaccctacgatttaaattcatggaaggaatcagaagggggtcttcaattggcggat
tccctagacgaagatgctgtcattgtggaagggtacccagagtacgccacttggagacct
cacctggcatacatgagagacccaaacggtaatccagaagacgaaatggaattggacggt
attggaggggtctcgattctcgcgaaagctaaagtattcagaacaggctcacactttcct
gcattctcctttgaaaagcacgcagagacagaagcattcggtaggctctcccgcaggatg
aattacaatgtcatcggcttgccccattatgtcatctggcacatctacgaaccttccagc
gacgacttaaagcacatggcttggatggctgaagaggagaagcggaaactagaagaagag
agaattcgcgaattttacaacaagatctgggagattggatttgaagatgtcagagaccaa
tggaacgaagaaagagattcaatcttaaaaaacattgactccactttgaacaataaagtc
actgtagactggtctgaagagggagatggctcggagctggtggactcaaagggtgacttt
gtctcaccaaacaaccaacaacaacaacaacagcaacaacaacaacaacagcagcagcag
caacagcaacagcaacaacagctcgacggcaacccgcaggggaaacctcttgatgacaac
gacaagaacaagaaaaaacatcctaaagaagttccattagacttcgaccctgatagaaac
tag

DBGET integrated database retrieval system