KEGG   Saccharomyces cerevisiae (budding yeast): YNL192WHelp
Entry
YNL192W           CDS       T00005                                 

Gene name
CHS1, USA4
Definition
chitin synthase CHS1 (EC:2.4.1.16)
Orthology
K00698  
chitin synthase [EC:2.4.1.16]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Amino sugar and nucleotide sugar metabolism
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sce00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
XIV:276502..279897
Genome map
AA seq 1131 aa AA seqDB search
MSDQNNRSRNEYHSNRKNEPSYELQNAHSGLFHSSNEELTNRNQRYTNQNASMGSFTPVQ
SLQFPEQSQQTNMLYNGDDGNNNTINDNERDIYGGFVNHHRQRPPPATAEYNDVFNTNSQ
QLPSEHQYNNVPSYPLPSINVIQTTPELIHNGSQTMATPIERPFFNENDYYYNNRNSRTS
PSIASSSDGYADQEARPILEQPNNNMNSGNIPQYHDQPFGYNNGYHGLQAKDYYDDPEGG
YIDQRGDDYQINSYLGRNGEMVDPYDYENSLRHMTPMERREYLHDDSRPVNDGKEELDSV
KSGYSHRDLGEYDKDDFSRDDEYDDLNTIDKLQFQANGVPASSSVSSIGSKESDIIVSND
NLTANRALKRSGTEIRKFKLWNGNFVFDSPISKTLLDQYATTTENANTLPNEFKFMRYQA
VTCEPNQLAEKNFTVRQLKYLTPRETELMLVVTMYNEDHILLGRTLKGIMDNVKYMVKKK
NSSTWGPDAWKKIVVCIISDGRSKINERSLALLSSLGCYQDGFAKDEINEKKVAMHVYEH
TTMINITNISESEVSLECNQGTVPIQLLFCLKEQNQKKINSHRWAFEGFAELLRPNIVTL
LDAGTMPGKDSIYQLWREFRNPNVGGACGEIRTDLGKRFVKLLNPLVASQNFEYKMSNIL
DKTTESNFGFITVLPGAFSAYRFEAVRGQPLQKYFYGEIMENEGFHFFSSNMYLAEDRIL
CFEVVTKKNCNWILKYCRSSYASTDVPERVPEFILQRRRWLNGSFFASVYSFCHFYRVWS
SGHNIGRKLLLTVEFFYLFFNTLISWFSLSSFFLVFRILTVSIALAYHSAFNVLSVIFLW
LYGICTLSTFILSLGNKPKSTEKFYVLTCVIFAVMMIYMIFCSIFMSVKSFQNILKNDTI
SFEGLITTEAFRDIVISLGSTYCLYLISSIIYLQPWHMLTSFIQYILLSPSYINVLNIYA
FCNVHDLSWGTKGAMANPLGKINTTEDGTFKMEVLVSSSEIQANYDKYLKVLNDFDPKSE
SRPTEPSYDEKKTGYYANVRSLVIIFWVITNFIIVAVVLETGGIADYIAMKSISTDDTLE
TAKKAEIPLMTSKASIYFNVILWLVALSALIRFIGCSIYMIVRFFKKVTFR
NT seq 3396 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatcaaaataatcgatcgagaaatgaatatcactcaaaccggaagaatgaacct
tcctatgaactccaaaatgcacatagcgggctatttcactcttctaatgaagaattaaca
aacaggaaccaaagatataccaatcaaaatgccagcatgggttcattcactccagtccaa
tctttgcaatttccagaacaatctcagcaaacaaatatgctttataacggtgacgatggc
aataataatactatcaatgataacgaacgagacatatatggaggttttgtcaaccaccat
cgccagcgtcccccaccagcaactgcagaatacaatgacgtttttaatacgaatagtcaa
cagctaccgtcggaacatcaatacaataacgtaccttcatatccacttccttcgataaat
gtgattcaaaccactccagaactcatacataacggctcacagactatggccacccccatc
gaaaggcccttctttaacgaaaacgactactattataataacaggaactctaggacgtca
ccgagtattgcttctagtagcgatggttatgcagatcaggaagctaggcccattttggag
caacccaacaataacatgaatagcggtaatattcctcaataccatgaccaaccttttgga
tacaacaatggttaccatggcctacaggcaaaagattactatgacgatccggagggtggt
tatattgatcagagaggagatgactatcagattaattcatatttgggtagaaacggtgaa
atggttgatccttacgattatgaaaacagtttaagacatatgactcctatggagcgtaga
gaatatcttcatgatgatagcagacccgtaaacgatggaaaagaagaattagacagtgtg
aaaagcggttactctcatagagacttgggggaatatgacaaggatgatttttcaagggat
gacgagtacgatgatctcaacactattgataaattacagtttcaagctaatggtgtacct
gcatcatcctcggtgtcttctatcggatctaaagaatccgacataatagtaagcaatgat
aacttaaccgcaaatagagcactaaagagaagcggtactgaaattaggaaattcaaactt
tggaatggtaattttgttttcgattctccaatcagtaagacgctattggaccaatacgct
actacaacagaaaatgcaaacactttaccaaatgagtttaagtttatgagatatcaagca
gttacttgcgaacctaatcaacttgcagagaagaatttcacggtgaggcagttgaagtat
ttaactccaagggaaacggaattgatgctagtagtcacaatgtataatgaagaccatatc
ctgttaggaagaactttgaaaggtattatggacaatgtcaaatatatggtgaaaaaaaaa
aattcaagcacttgggggccggatgcatggaaaaagattgtcgtttgtatcatttcagat
ggtagatccaaaattaatgaacgctcgctagcattactaagttcgttaggttgttaccag
gacgggtttgctaaggatgaaattaatgaaaaaaaagtggcaatgcatgtctacgaacat
acgacaatgatcaacatcacaaatatttcggaatcagaggtttcattagaatgcaatcaa
ggtaccgttccaatacaacttttgttttgtttgaaagagcaaaatcagaaaaaaattaac
tcacatagatgggcatttgaaggctttgcagaattactgcgtcccaatatcgttacattg
ttagatgctggtaccatgccaggtaaagattctatttaccagttatggagagagttcagg
aatccaaatgttggtggcgcatgtggtgaaataagaactgatttgggtaagagatttgta
aagcttttgaatcctttagttgcatcacagaatttcgaatacaaaatgtccaatatttta
gacaaaacaaccgagtctaactttggatttattactgttctaccgggggcattctctgcg
tataggtttgaagctgtgagaggccaaccattacagaagtacttttatggtgaaattatg
gaaaatgaaggttttcattttttttcttccaatatgtatcttgctgaagatcgtatttta
tgctttgaagtggtcacaaaaaaaaattgtaattggattttgaaatactgcagaagttct
tatgcttcaacagatgtaccggagagggtccctgaatttattcttcagaggaggcgttgg
ttgaatggttcattttttgctagtgtatattccttttgtcatttttacagagtctggagc
agtggtcataatattggtagaaaactccttttgacggttgaatttttttaccttttcttc
aatacattgatttcatggttttcattgagttcatttttcctagtctttagaattctcact
gtttctattgcactggcataccattcagcatttaatgtgttgtccgtcatattcctgtgg
ctttatgggatttgtaccttatcaacattcatactgtcattgggtaataaacctaaaagt
actgagaaattttatgttctaacttgcgtcatttttgcggtgatgatgatttacatgata
ttctgcagtatattcatgagtgtcaaatccttccaaaatatattgaaaaacgataccatc
agctttgagggtttgattaccacagaagctttcagggatattgttatctctctgggctcc
acttattgtttgtacctaatcagttcaattatctatttgcagccatggcatatgttgaca
agttttattcagtatattttattgagtccttcttacatcaatgttttgaatatctatgca
ttttgtaatgtccacgacttatcatggggtacaaagggtgcaatggcaaatccgctgggt
aagattaatactacagaagatggtacgttcaaaatggaagttctggtctctagttcagag
attcaagcaaactacgataaatatttgaaagttttaaatgacttcgatccaaaatcagaa
tctcggcctactgagccatcttatgatgaaaaaaagactggctattatgcaaacgttaga
tctctcgtgattatcttttgggtcatcacaaatttcatcatcgttgctgttgtcttagaa
accggtgggattgcagattatattgctatgaaatccatatcaactgatgacactttagaa
actgcaaagaaggcggaaattcccttaatgaccagtaaggcctcaatttattttaatgta
attttatggttagttgcattatcggcattaataaggttcattggttgctcaatatacatg
atagtaaggttttttaaaaaggttacatttcgctaa

DBGET integrated database retrieval system